Joystiq http://www.joystiq.com Joystiq http://www.blogsmithmedia.com/http://www.joystiq.com/media/feedlogo.gif Joystiq http://www.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[GameStop opens digital storefront on Facebook]]>http://www.joystiq.com/2011/04/08/gamestop-opens-digital-storefront-on-facebook/http://www.joystiq.com/2011/04/08/gamestop-opens-digital-storefront-on-facebook/http://www.joystiq.com/2011/04/08/gamestop-opens-digital-storefront-on-facebook/#comments If you're uncomfortable with GameStop's tenacity as it pursues your reservations and trade-ins, you'll probably be displeased to learn that "pre-order pokes" could be coming in the near future. The gargantuan games retailer recently opened up a Facebook storefront, through which shoppers can purchase and reserve titles, view trailers and screenshot galleries and, in the near future, earn and redeem PowerUp Rewards points.

Between this and GameStop's recent acquisition of Impulse and Spawn Labs, it seems the retailer's taking its new digital strategy pretty seriously. We wouldn't be surprised to see if the company adopted a presence on LiveJournal, as well. We'd be curious to learn what its mood is like on a day-to-day basis, as well as what hot bands it's totally into right now.

JoystiqGameStop opens digital storefront on Facebook originally appeared on Joystiq on Fri, 08 Apr 2011 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>facebookgamestopindustrymarketplaceonlinepcpowerup-rewardspre-orderretailFri, 08 Apr 2011 08:00:00 EST<![CDATA[Blizzard: StarCraft 2 'marketplace' still coming]]>http://www.joystiq.com/2011/03/17/blizzard-starcraft-2-marketplace-still-coming/http://www.joystiq.com/2011/03/17/blizzard-starcraft-2-marketplace-still-coming/http://www.joystiq.com/2011/03/17/blizzard-starcraft-2-marketplace-still-coming/#comments During BlizzCon 2009, Blizzard revealed plans to put a shopping interface inside StarCraft 2, which would allow players to purchase user-created maps, with revenue shared between Blizzard and the creator. The game came out in July 2010, sans marketplace, and that feature is still missing.

During an interview with MTV Multiplayer, Blizzard's Frank Pearce asserted that the feature is still on the way. "But it's not necessarily something we have a specific timeline for," he said, "which is unfortunate because one of the things that we've found is, especially from our learnings from World of WarCraft, is that these audiences that play these games are very, very passionate and want to experience lots and lots of content. With the StarCraft 2 client and the StarCraft 2 map editor and the Battle.net platform, it creates an opportunity for the community to serve itself with content, if the mechanisms are there."

To be fair, if it did have a timeline, it would be a Blizzard timeline, and therefore could only be specific to the year. Approximately.

JoystiqBlizzard: StarCraft 2 'marketplace' still coming originally appeared on Joystiq on Thu, 17 Mar 2011 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>blizzardfrank-pearcemarketplacepcstarcraft-2Starcraft-2-Wings-of-LibertyUGCuser-created-contentThu, 17 Mar 2011 16:00:00 EST<![CDATA[Civil War breaks out on XBLM, Marvel Ultimate Alliance 2 demo released]]>http://www.joystiq.com/2009/11/05/civil-war-breaks-out-on-xblm-marvel-ultimate-alliance-2-demo-re/http://www.joystiq.com/2009/11/05/civil-war-breaks-out-on-xblm-marvel-ultimate-alliance-2-demo-re/http://www.joystiq.com/2009/11/05/civil-war-breaks-out-on-xblm-marvel-ultimate-alliance-2-demo-re/#comments If this Thursday finds you in a superheroic mood, a recent addition to the Xbox Live Marketplace might just serve as an excellent outlet for you to dish out some costumed justice. Major Nelson recently confirmed that a demo for Marvel Ultimate Alliance 2 has been added to the service. Sure, it's a bit tardy, considering the game came out nearly two months ago. Still, we'll happily accept any free opportunities we can get to pretend to be Gambit for a few minutes. We kin' try talkin' like dis', ma cherie, but ... well, it doesn't really cut it.

JoystiqCivil War breaks out on XBLM, Marvel Ultimate Alliance 2 demo released originally appeared on Joystiq on Thu, 05 Nov 2009 12:45:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>activisiondemomarketplacemarvelMarvel-Ultimate-Alliance-2super-heroxblmThu, 05 Nov 2009 12:45:00 EST<![CDATA[PSA: PayPal now works for purchases on Xbox.com]]>http://www.joystiq.com/2009/08/07/psa-paypal-now-works-for-purchases-on-xbox-com/http://www.joystiq.com/2009/08/07/psa-paypal-now-works-for-purchases-on-xbox-com/http://www.joystiq.com/2009/08/07/psa-paypal-now-works-for-purchases-on-xbox-com/#comments
If using a credit card online rubs you the wrong way -- or your extreme laziness prevents you from leaving your home to purchase a points card -- PayPal can now be used to buy Microsoft Points on Xbox.com. There are a few caveats to the new option, however: The new payment method is only available to US residents and will only work through Xbox.com (not your actual console).

Users can attach multiple PayPal accounts to their Gamertags and purchase points, which can then be used to purchase content -- like (the insanely priced) Xbox 360 Games on Demand titles. To add a PayPal account, follow these easy steps:
  • Sign in to Xbox.com
  • Direct your browser to the Account Summary page
  • Select "Manage Payment Option"
  • Click "Add a new PayPal Account" and follow the onscreen instructions.
Your virtual wallet will be filled with Microsoft Funny Money in no time!

JoystiqPSA: PayPal now works for purchases on Xbox.com originally appeared on Joystiq on Fri, 07 Aug 2009 14:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>marketplacepaymentpayment-optionspaypalxbox-live-marketplacexbox.comFri, 07 Aug 2009 14:30:00 EST<![CDATA[Games for Windows Live goes 3.0]]>http://www.joystiq.com/2009/08/06/games-for-windows-live-goes-3-0/http://www.joystiq.com/2009/08/06/games-for-windows-live-goes-3-0/http://www.joystiq.com/2009/08/06/games-for-windows-live-goes-3-0/#comments
If you were running about the Capital Wasteland in Fallout 3 or tossing hadoukens in Street Fighter IV on your PC recently, you may have noticed a Games For Windows Live update. Microsoft reports the new update is now available, which adds the Marketplace, anti-piracy measures and a host of other new features to the PC suite. Congrats, Microsoft! You've finally turned our PCs into Xbox 360s!

[Thanks, Kent!]

Gallery: Games for Windows Live

JoystiqGames for Windows Live goes 3.0 originally appeared on Joystiq on Thu, 06 Aug 2009 14:14:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>anti-piracygames-for-windowsgames-for-windows-livemarketplacemicrosoftpiracyupdateThu, 06 Aug 2009 14:14:00 EST<![CDATA[Halo-themed Avatar clothing spotted in the wild]]>http://www.joystiq.com/2009/06/27/halo-themed-avatar-clothing-spotted-in-the-wild/http://www.joystiq.com/2009/06/27/halo-themed-avatar-clothing-spotted-in-the-wild/http://www.joystiq.com/2009/06/27/halo-themed-avatar-clothing-spotted-in-the-wild/#comments
Select individuals have been seen sporting Halo-themed Avatar clothing recently, with fine young gentleman Randy No Arms being the latest spotted. It makes sense, considering the guy works for Microsoft, but are these new duds a part of the Avatar rewards beta, or is this the Avatar marketplace at work? Regardless, we're totally jealous he's sporting a slew of Halo-branded clothes, including a hat emblazoned with the UNSC symbol, a shirt with a pair of crossed energy swords, and a nice pair of khaki shorts with the Spartan helmet on the left leg.

Be sure to hit up our gallery below for some shots of the Avatar marketplace from E3, complete with Gears of War 2 and Halo storefronts.

JoystiqHalo-themed Avatar clothing spotted in the wild originally appeared on Joystiq on Sat, 27 Jun 2009 19:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>avatargears-of-wargears-of-war-2halohalo-3marketplaceMicrosoftXbox-360xbox-liveSat, 27 Jun 2009 19:00:00 EST<![CDATA[Gears of War 2: Microsoft flubs gold Lancer offer [update]]]>http://www.joystiq.com/2009/01/28/gears-of-war-2-microsoft-flubs-gold-lancer-offer/http://www.joystiq.com/2009/01/28/gears-of-war-2-microsoft-flubs-gold-lancer-offer/http://www.joystiq.com/2009/01/28/gears-of-war-2-microsoft-flubs-gold-lancer-offer/#commentsFiled under:


A Microsoft representative has informed Joystiq that the public availability of the Gears 2 Gold Lancer was made in error. Yesterday, we reported that the exclusive Collector's Edition weapon had appeared on the Xbox.com Marketplace for all to wield.

According to the rep, everyone who obtained the Gold Lancer from the Xbox.com Marketplace will have the item removed from their games in an upcoming fix, in order to keep the weapon exclusive to Gears 2 Collector's Edition consumers. "We're currently attempting a fix that will expire all codes that were unexpectedly released in error through Xbox LIVE Marketplace," the representative noted.

How Microsoft will remove (or possibly disable) the art asset file and differentiate between legitimate owners and those who grabbed the guns as they fell off the back of the truck is unclear. A request for clarification on how or when the fix would be implemented has gone unanswered, but we'll update you as soon as we know more.

Update: While the original listing for the Gold Lancer remains on the Xbox.com Marketplace, the item now shows a price of 99999. Gold Lancers received through the error have yet to be removed.

JoystiqGears of War 2: Microsoft flubs gold Lancer offer [update] originally appeared on Joystiq on Wed, 28 Jan 2009 13:53:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>collectors-editionepic-gamesgears-of-war-2marketplaceMicrosoftmicrosoft-game-studiosXbox-360Wed, 28 Jan 2009 13:53:00 EST<![CDATA[Resident Evil 5 demo now infects XBLM worldwide]]>http://www.joystiq.com/2009/01/26/resident-evil-5-demo-now-infects-xblm-worldwide/http://www.joystiq.com/2009/01/26/resident-evil-5-demo-now-infects-xblm-worldwide/http://www.joystiq.com/2009/01/26/resident-evil-5-demo-now-infects-xblm-worldwide/#commentsFiled under: , ,


Attention Resident Evil fans not currently living on the island nation of Japan: The Resident Evil 5 demo is now available to Xbox Live Gold members everywhere (except Germany). The demo contains two levels and allows for co-op play both offline and over Xbox Live. There don't appear to be any major differences between this demo and the demo that was released in Japan last month, so don't expect any surprises if you managed to play it before. Actually, there might be one surprise: It probably won't stop working week from now.

Go ahead and queue up your download right now. While you're waiting, why not check out our impressions of the Japanese demo after the break? It'll do you good.

Continue reading Resident Evil 5 demo now infects XBLM worldwide

JoystiqResident Evil 5 demo now infects XBLM worldwide originally appeared on Joystiq on Mon, 26 Jan 2009 10:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>capcomdemolive-marketplacemarketplaceresident-evilresident-evil-5xblmxbox-live-marketplaceMon, 26 Jan 2009 10:00:00 EST<![CDATA[Tomb Raider: Underworld DLC set for Feb. 10, March 10]]>http://www.joystiq.com/2009/01/22/tomb-raider-underworld-dlc-set-for-feb-10-march-10/http://www.joystiq.com/2009/01/22/tomb-raider-underworld-dlc-set-for-feb-10-march-10/http://www.joystiq.com/2009/01/22/tomb-raider-underworld-dlc-set-for-feb-10-march-10/#commentsFiled under: , ,


Having been delayed late last year thanks to layoffs at Crystal Dynamics, Eidos has officialy set a new date for the Tomb Raider: Underworld DLC. The first content pack, "Beneath the Ashes," is set to arrive on February 10 and finds Lara exploring the ruins of Croft Manner to discover a hidden "deadly source of power" amidst ancient caverns and crypts. Frankly, we hope the DLC unravels the mystery as to why the Crofts decided to build their mansion on top of so many caverns and crypts in the first place. "Beneath the Ashes" will also contain six new costumes for Lara and new achievements worth 125 points.

The second batch of DLC, "Lara's Shadow," will be available March 10. No details were released regarding the second pack, but it's probably safe to assume it will also contain a new level, costumes, and achievements. No prices were announced, though GameStop lists both packs combined for $20, leading us to believe they will be individually priced at 800 points.

It's worth noting that former creative director for Crystal Dynamics, Eric Lindstrom, has stated that the DLC levels were originally intended to be included in the retail game, but were cut as the result of "a production issue" that would have caused the game to miss its ship date.

JoystiqTomb Raider: Underworld DLC set for Feb. 10, March 10 originally appeared on Joystiq on Thu, 22 Jan 2009 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>crystal-dynamicsdlcdownloadable-contenteidoslive-marketplacemarketplacetomb-raidertomb-raider-underworldxblmxbox-live-marketplaceThu, 22 Jan 2009 13:00:00 EST<![CDATA['New' Resident Evil 5 trailer hits the web, XBLM]]>http://www.joystiq.com/2009/01/19/new-resident-evil-5-trailer-hits-the-web-xblm/http://www.joystiq.com/2009/01/19/new-resident-evil-5-trailer-hits-the-web-xblm/http://www.joystiq.com/2009/01/19/new-resident-evil-5-trailer-hits-the-web-xblm/#commentsFiled under: , ,

As we so craftily implied with the quotes in the above headline, this Resident Evil 5 trailer isn't technically new. It was actually shown at the 2008 Tokyo Game Show. The catch, you see, is that it was only shown at the Tokyo Game Show, and we were all prevented from seeing it in its full, high definition glory. But that was the past, as the trailer is now available to one and all and it's a doozy. Seriously, this sucker is over five minutes long. It's probably the closest look at the game's story that we've been given so far -- what's Umbrella doing in an African cave? -- and it has a extra strength dose of Wesker. Be sure to watch the whole thing, as Jill Valentine makes a cameo (of sorts).

Also, for those who'd rather watch from the couch, the trailer is now available on Xbox Live Marketplace as well.

Joystiq'New' Resident Evil 5 trailer hits the web, XBLM originally appeared on Joystiq on Mon, 19 Jan 2009 12:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>capcomlive-marketplacemarketplaceresident-evilresident-evil-5xblmxbox-live-marketplaceMon, 19 Jan 2009 12:30:00 EST<![CDATA[Cardigans, Rihanna, Fall Out Boy DLC for Lips this month]]>http://www.joystiq.com/2009/01/15/cardigans-rihanna-fall-out-boy-dlc-for-lips-this-month/http://www.joystiq.com/2009/01/15/cardigans-rihanna-fall-out-boy-dlc-for-lips-this-month/http://www.joystiq.com/2009/01/15/cardigans-rihanna-fall-out-boy-dlc-for-lips-this-month/#commentsFiled under: ,

Microsoft has detailed upcoming Lips DLC for the remainder of January, and it's an interesting mix to say the least. Ranging from artists like Rihanna, the Cardigans, the Pussycat Dolls and even Boyz II Men, there's something for everyone. The songs will range from 160 to 180 Microsoft Points, with the first batch due out this Friday (hey, that's tomorrow). Check out the complete list below. See anything you like?

January 16
  • When I Grow Up - The Pussycat Dolls (160)
  • You've Lost That Lovin' Feelin' - The Righteous Brothers (180)
  • Erase/Rewind - The Cardigans (160)
January 23
  • Hate That I Love You - Rihanna feat. Ne-Yo (180)
  • Thnks fr th Mmrs - Fall Out Boy (160)
  • Look What You've Done - Jet (160)
January 30
  • Sunday Morning - Maroon 5 (160)
  • Take A Bow - Rihanna (180)
  • Water Runs Dry - Boyz II Men (160)

JoystiqCardigans, Rihanna, Fall Out Boy DLC for Lips this month originally appeared on Joystiq on Thu, 15 Jan 2009 14:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>dlcinislipslive-marketplacemarketplacemicrosoft-game-studiosxblmxbox-live-marketplaceThu, 15 Jan 2009 14:30:00 EST<![CDATA[Blowout headed to Xbox Originals (wait, what?)]]>http://www.joystiq.com/2009/01/14/blowout-headed-to-xbox-originals-wait-what/http://www.joystiq.com/2009/01/14/blowout-headed-to-xbox-originals-wait-what/http://www.joystiq.com/2009/01/14/blowout-headed-to-xbox-originals-wait-what/#commentsFiled under: ,


If you happened to catch a recent Twitter update from Major Nelson, you may have already discovered that BlowOut is the next title headed to Xbox Originals. Supposing this is the first you've heard of it -- Gamerscore Blog just made it official -- we imagine your reaction is much the same as ours was. That is to say a reaction of complete puzzlement. It's not that we think BlowOut is a poor choice for Xbox Originals (an accusation we could level at many previous choices). No, it's that we have no idea what BlowOut is. We canvassed our coworkers and no one remembers BlowOut. At all.

Thankfully, it appears the game's official website is still active and we think it tells you everything you need to know. It's a side scroller. You shoot things. A lot. Oh, and the tagline is priceless. It concerns the game's main character, a space marine nicknamed Dutch. Ahem: "Mess with Dutch, don't live much!!!" (Note the triple exclamation points. Very important.)

BlowOut will hit Marketplace on January 19th for 1200 Microsoft Points.

JoystiqBlowout headed to Xbox Originals (wait, what?) originally appeared on Joystiq on Wed, 14 Jan 2009 15:15:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>blowoutlive-marketplacemarketplacexblmxbox-live-marketplacexbox-originalsWed, 14 Jan 2009 15:15:00 EST<![CDATA[The Eagles take flight as GH: World Tour DLC]]>http://www.joystiq.com/2008/12/18/the-eagles-take-flight-as-gh-world-tour-dlc/http://www.joystiq.com/2008/12/18/the-eagles-take-flight-as-gh-world-tour-dlc/http://www.joystiq.com/2008/12/18/the-eagles-take-flight-as-gh-world-tour-dlc/#commentsFiled under: , ,

Guitar Hero: World Tour players listen up. You've got some brand new DLC to download today, and it comes in the form of an Eagles track pack. Yes, you can finally play something other than "Hotel California." That's right. Just sit back and let the relief wash over you. Feels good, doesn't it? You can pick up all three tracks for 440 ($5.50) or download individual tracks for 160 ($2.00) each. The tracks available are:

JoystiqThe Eagles take flight as GH: World Tour DLC originally appeared on Joystiq on Thu, 18 Dec 2008 10:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>activisionghwtguitar-heroguitar-hero-world-tourlive-marketplacemarketplaceneversoftx3f-twitterxblmxbox-live-marketplaceThu, 18 Dec 2008 10:30:00 EST<![CDATA[Gold Live members: Free premium Winter Holiday theme]]>http://www.joystiq.com/2008/12/10/gold-live-members-free-premium-winter-holiday-theme/http://www.joystiq.com/2008/12/10/gold-live-members-free-premium-winter-holiday-theme/http://www.joystiq.com/2008/12/10/gold-live-members-free-premium-winter-holiday-theme/#commentsFiled under: ,


Pssst. Hey, Gold Xbox Live members, over here. This post is just for you. Are the Silver members gone? Good. Okay, here's the deal. Major Nelson has informed us that you (just you, not Silver members) are now entitled to a free Winter Holiday theme. Since neither Major nor Xbox.com provide any images of the Winter theme, we snapped a quick spy picture. We even made it kind of blurry and took at an awkward angle to make it seem more clandestine. Cool, huh? Anyway, like we said, it's free. You can download it by clicking this link. Just don't tell the Silver members. If they ever learn of our opulence, surely they will revolt.

JoystiqGold Live members: Free premium Winter Holiday theme originally appeared on Joystiq on Wed, 10 Dec 2008 13:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>live-marketplacemarketplacethemesxblmxbox-live-marketplaceWed, 10 Dec 2008 13:30:00 EST<![CDATA[XBLM Holiday Deal of the Week: Legendary Map Pack for 400 points]]>http://www.joystiq.com/2008/12/01/xblm-holiday-deal-of-the-week-legendary-map-pack-for-400-points/http://www.joystiq.com/2008/12/01/xblm-holiday-deal-of-the-week-legendary-map-pack-for-400-points/http://www.joystiq.com/2008/12/01/xblm-holiday-deal-of-the-week-legendary-map-pack-for-400-points/#commentsFiled under: , ,

Major Nelson sends word that Microsoft is beginning a new promotion this week, the Xbox Live Marketplace Holiday Deal of the Week. Throughout December, Microsoft will announce a new deal of the week for Gold members only on a certain content from the Xbox Live Marketplace. This week's deal is the Legendary Map Pack for Halo 3, which will be discounted from 600 Microsoft Points to 400 starting tomorrow (Halo fans may recall that the original 800 point price was reduced to 600 earlier this year).

For only five bucks, you can grab three maps for Halo 3 which include Ghost Town, Avalanche and Blackout. The deal will only be available for one week -- again, starting tomorrow -- so you'd best think fast if you want to take advantage of it. A new deal will be announced next Monday and more deals are expected to follow throughout December.

JoystiqXBLM Holiday Deal of the Week: Legendary Map Pack for 400 points originally appeared on Joystiq on Mon, 01 Dec 2008 16:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>343-Industriesbungiebungie-studiosdeal-of-the-weekFPShalohalo-3legendary-map-packlive-marketplacemarketplaceMicrosoft-Game-Studiosxblmxblm-holiday-deal-of-the-weekxblm-holiday-dotwxbox-live-marketplaceMon, 01 Dec 2008 16:00:00 EST<![CDATA[Four DLC packs for Last Remnant in December]]>http://www.joystiq.com/2008/11/29/four-dlc-packs-for-last-remnant-in-december/http://www.joystiq.com/2008/11/29/four-dlc-packs-for-last-remnant-in-december/http://www.joystiq.com/2008/11/29/four-dlc-packs-for-last-remnant-in-december/#commentsFiled under: ,


If you've been able to look past the numerous reported technical issues with The Last Remnant, you should be happy to hear that that three downloadable content packs are on the way for the game. The first, Challenge Pack 1: Purgatory's Sins, will be available to Xbox Live Gold members on December 1 and Silver members on December 8. This pack includes new guild tasks. Also available on these dates will be The Key of Ancient Ruins which, appropriately enough, unlocks the Ancient Ruins in the game. The third bit of DLC, Challenge Pack 2: The Price of Lies, which includes more guild tasks, will be available to Gold members on December 22 and Silver members on the 29th. All three of the above content packs will be completely free.

Finally, March to War, which was previously available only to those who had pre-ordered the game, will be made available to both Gold and Silver members on December 15 for 100 Microsoft Points. March to War adds three more formations for the game: Scatterswarm, Goblet and Catapult.

JoystiqFour DLC packs for Last Remnant in December originally appeared on Joystiq on Sat, 29 Nov 2008 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>last-remnantlive-marketplacemarketplacesquaresquare-enixthe-last-remnantxblmxbox-live-marketplaceSat, 29 Nov 2008 15:00:00 EST<![CDATA[Resident Evil 5 demo on Dec. 5 says Famitsu]]>http://www.joystiq.com/2008/11/26/resident-evil-5-demo-on-dec-5-says-famitsu/http://www.joystiq.com/2008/11/26/resident-evil-5-demo-on-dec-5-says-famitsu/http://www.joystiq.com/2008/11/26/resident-evil-5-demo-on-dec-5-says-famitsu/#commentsFiled under: ,


As if we weren't already up to our eyeballs in zombies, the latest issue of Famitsu (as translated by IGN) states that Capcom plans to release a demo of Resident Evil 5 onto Xbox Live Marketplace on December 5*. The demo will include two playable stages and will include both offline and co-op modes. Caveat alert: as Famitsu is a Japanese magazine, the demo is currently only confirmed for Japan. We have our top men (top men) needling Capcom about the matter, so hopefully we'll have a confirmed demo for other regions shortly.

[Via Joystiq]

*Yes, we realize that the enemies in Resident Evil 5 are not technically zombies, as established in Resident Evil 4 but, for all intents and purposes, they're zombies, mkay? And furthermore, seriously, come on, we're telling you that there is a Resident Evil 5 demo merely a week away and you're arguing semantics? Really? That's how you want to spend your time? Fine. Suits us. We don't even care. Jerk.

JoystiqResident Evil 5 demo on Dec. 5 says Famitsu originally appeared on Joystiq on Wed, 26 Nov 2008 13:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>capcomlive-marketplacemarketplaceresident-evil-5xbox-live-marketplaceWed, 26 Nov 2008 13:30:00 EST<![CDATA[Dead Space Demo dismembers XBLM]]>http://www.joystiq.com/2008/11/25/dead-space-demo-dismembers-xblm/http://www.joystiq.com/2008/11/25/dead-space-demo-dismembers-xblm/http://www.joystiq.com/2008/11/25/dead-space-demo-dismembers-xblm/#commentsFiled under: , ,


We realize that many of our readers have long since forgotten Halloween -- its memory having been replaced by slavering thoughts of turkey -- but that doesn't mean we have to forget about survival horror. In an effort to remind us -- and perhaps to push a few more copies out the door -- EA has released a demo for Dead Space onto the Xbox Live Marketplace (sorry, Gold members only, for now). The demo is vaguely referred to as a "Dismemberment Demo" and, frankly, we haven't the foggiest idea what that's about. And hey, check this out, thanks to the new online Marketplace at Xbox.com, we can do this:

Click here to add the Dead Space demo to your 360 download queue!

JoystiqDead Space Demo dismembers XBLM originally appeared on Joystiq on Tue, 25 Nov 2008 11:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>dead-spaceeaea-redwood-shoresearselectronic-artslive-marketplacemarketplacexblmxbox-live-marketplaceTue, 25 Nov 2008 11:00:00 EST<![CDATA[New Killers album tracks headed to GH World Tour]]>http://www.joystiq.com/2008/11/14/new-killers-album-tracks-headed-to-gh-world-tour/http://www.joystiq.com/2008/11/14/new-killers-album-tracks-headed-to-gh-world-tour/http://www.joystiq.com/2008/11/14/new-killers-album-tracks-headed-to-gh-world-tour/#commentsFiled under: , ,

Activision announced today that a new Guitar Hero: World Tour track pack from The Killers will release simultaneously with their new album Day & Age. The two new tracks included in the pack are "Human" and "Losing Touch." The third song in the pack is the band's original hit "Mr. Brightside." The track pack will be released alongside Day & Age on November 25. Those looking to pick up the new tracks can expect to plunk down 440 Microsoft Points, otherwise known as $5.50.

JoystiqNew Killers album tracks headed to GH World Tour originally appeared on Joystiq on Fri, 14 Nov 2008 12:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ghwtguitar-heroguitar-hero-world-tourlive-marketplacemarketplacexblmxbox-live-marketplaceFri, 14 Nov 2008 12:45:00 EST<![CDATA[Full PC games on 'road map' of GFW Marketplace]]>http://www.joystiq.com/2008/11/12/full-pc-games-on-road-map-of-gfw-live-marketplace/http://www.joystiq.com/2008/11/12/full-pc-games-on-road-map-of-gfw-live-marketplace/http://www.joystiq.com/2008/11/12/full-pc-games-on-road-map-of-gfw-live-marketplace/#commentsFiled under: , ,

road map
Full game digital distribution is in the cards for Games For Windows Live, we just don't know when that hand will be dealt. "Clearly it's on our road map," GM Chris Early confirmed to Shacknews. An update to the service today added video, demo and DLC support to Microsoft's PC Marketplace.

Should services like Steam be concerned? Not yet, at least. But with Microsoft already locking up exclusive content for GFW Live (see Fallout 3 PC DLC), there's precedence to suggest the company could scoop into its considerable war chest and strike up some exclusivity deals when it gets around to offering full releases. Of course, Microsoft is known for taking its sweet time getting to the ultimate destination. Road maps can be complicated, you know?

JoystiqFull PC games on 'road map' of GFW Marketplace originally appeared on Joystiq on Wed, 12 Nov 2008 17:14:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>digital-distributiongames-for-windows-livemarketplacemicrosoftPCWed, 12 Nov 2008 17:14:00 EST<![CDATA[Left 4 Dead demo zombifies XBLM]]>http://www.joystiq.com/2008/11/11/left-4-dead-demo-zombifies-xblm/http://www.joystiq.com/2008/11/11/left-4-dead-demo-zombifies-xblm/http://www.joystiq.com/2008/11/11/left-4-dead-demo-zombifies-xblm/#commentsFiled under: ,


We're not even sure why you're sitting there reading this. If we were you -- and despite what your schizophrenic side tells you, we're not -- we would be running to our Xbox 360 and downloading right now. But, for the sake of formality: The Left 4 Dead demo is now on Xbox Live Marketplace for all to download and enjoy. The demo includes single-player and online multiplayer sections of the game and even supports two-player splitscreen support. Go get it already!

For those of you lucky enough to have the NXE, we should note that the demo is not currently showing up in the New Arrivals section of Game Demos on XBLM. We had to browse the All Games section for Left 4 Dead (it's under L!) in order to find it. Also, strangely, it can be found in the Game Demos section under the letter L, but only if you sort the list by popularity. Our best guess is that a cyber zombie has been chewing on the brains of Xbox Live. It's the only thing that makes sense, really.

JoystiqLeft 4 Dead demo zombifies XBLM originally appeared on Joystiq on Tue, 11 Nov 2008 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>left-4-deadlive-marketplacemarketplacevalvexblmxbox-live-marketplaceTue, 11 Nov 2008 12:00:00 EST<![CDATA[Mirror's Edge demo vaults onto Marketplace (lands on feet)]]>http://www.joystiq.com/2008/10/31/mirrors-edge-demo-vaults-onto-marketplace-lands-on-feet/http://www.joystiq.com/2008/10/31/mirrors-edge-demo-vaults-onto-marketplace-lands-on-feet/http://www.joystiq.com/2008/10/31/mirrors-edge-demo-vaults-onto-marketplace-lands-on-feet/#commentsFiled under: , ,


Do you have any of "those" friends? You know the ones. The ones that still think that video games are exclusively the domain of kindergartners, and anyone who plays them beyond grade school is a mentally stunted weirdo? If so, we suggest heartily that you show them the Mirror's Edge demo that just landed on Marketplace. If they're able to take in the beautiful, visceral visuals and still walk away unimpressed, we suggest you try again. Only the second time, you should play whilst wearing a smoking jacket and sipping on a glass of cognac, preferably while sitting in a wingback leather chair. If that doesn't work ... well, you don't need "those" kinds of friends.

JoystiqMirror's Edge demo vaults onto Marketplace (lands on feet) originally appeared on Joystiq on Fri, 31 Oct 2008 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>diceeaelectronic-artslive-marketplacemarketplacemirrors-edgexblmxbox-live-marketplaceFri, 31 Oct 2008 10:30:00 EST<![CDATA[Free N+ level pack leaps onto XBLM]]>http://www.joystiq.com/2008/10/15/free-n-level-pack-leaps-onto-xblm/http://www.joystiq.com/2008/10/15/free-n-level-pack-leaps-onto-xblm/http://www.joystiq.com/2008/10/15/free-n-level-pack-leaps-onto-xblm/#commentsFiled under: ,


Tiny ninja fans rejoice! A new level pack for the high jumpin', wall slidin' platformer N+ is now available on Xbox Live Marketplace. Oh, but that's not all. It's also 100% completely, totally free! So, that's pretty cool right? The folks at Metanet have also annoucned a new "contesque" in which you could win a copy of N+ on your platform of choice. All you have to do is send a picture of an N+ related costume or craft, or a piece of digital art. Head over to Metanet for full details, and go get that level pack!

[Thanks, Brian. Via Joystiq]

JoystiqFree N+ level pack leaps onto XBLM originally appeared on Joystiq on Wed, 15 Oct 2008 16:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>arcadelive-arcadelive-marketplacemarketplacemetanetn xblaxblmxbox-live-arcadexbox-live-marketplaceWed, 15 Oct 2008 16:00:00 EST<![CDATA[Fracture demo sends shockwaves through Xbox Live]]>http://www.joystiq.com/2008/09/18/fracture-demo-sends-shockwaves-through-xbox-live/http://www.joystiq.com/2008/09/18/fracture-demo-sends-shockwaves-through-xbox-live/http://www.joystiq.com/2008/09/18/fracture-demo-sends-shockwaves-through-xbox-live/#commentsFiled under: ,


Here we are, September 18, and the Fracture demo promised by LucasArts has landed on Xbox Live Marketplace. Weighing in at 772MB, the demo allows players to sample a section of Fracture's single player campaign. Using the game's terrain deformation system, players can try their hand at creating and destroying the landscape using a variety of weapons. Here's hoping that creating hills, holes, craters and spires is enough to keep things interesting. If you've been anxious to try out Fracture's much vaunted terrain deformation, give it a go.

JoystiqFracture demo sends shockwaves through Xbox Live originally appeared on Joystiq on Thu, 18 Sep 2008 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>day-1day-1-studiosday-oneday-one-studiosfracturelive-marketplacelucasartsmarketplacexbox-live-marketplaceThu, 18 Sep 2008 09:30:00 EST<![CDATA[Mercenaries 2 demo explodes onto Xbox Live]]>http://www.joystiq.com/2008/09/16/mercenaries-2-demo-explodes-onto-xbox-live/http://www.joystiq.com/2008/09/16/mercenaries-2-demo-explodes-onto-xbox-live/http://www.joystiq.com/2008/09/16/mercenaries-2-demo-explodes-onto-xbox-live/#commentsFiled under: ,


Three days after Pandemic announced that a Mercenaries 2 demo was on Xbox Live Marketplace, it finally emerges. Where was it hiding? We're not sure. Venezuela perhaps. Regardless of where it's been, it's available now for anyone who wants to give its particular brand of open world destruction a try. Be warned though, the demo only lasts for twenty minutes, and the timer doesn't reset when you die, and it boots you back to the dashboard when time is up. Better get that destruction in while you can (and hope that you can figure the game out without a tutorial).

JoystiqMercenaries 2 demo explodes onto Xbox Live originally appeared on Joystiq on Tue, 16 Sep 2008 09:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>eaelectronic-artslive-marketplacemarketplacemercenariesmercenaries-2pandemicxblmxbox-live-marketplaceTue, 16 Sep 2008 09:45:00 EST<![CDATA[Guitar Hero Aerosmith demo walks this way]]>http://www.joystiq.com/2008/09/08/guitar-hero-aerosmith-demo-walks-this-way/http://www.joystiq.com/2008/09/08/guitar-hero-aerosmith-demo-walks-this-way/http://www.joystiq.com/2008/09/08/guitar-hero-aerosmith-demo-walks-this-way/#commentsFiled under: ,


Considering it came out in June, it's a little curious that Activision is only now releasing a demo of Guitar Hero: Aerosmith to Xbox Live Marketplace. Somehow, we get the feeling that pretty much anyone interested in Guitar Hero: Aerosmith already has it. If, somehow, you're interested in this game and have yet to try it out, go give it try. Oh, one last thing, the dashboard details are priceless: "Get a taste of Guitar Hero(R): Aerosmith - There's never been a band like them; there has never been a game like this." Really? Never?

JoystiqGuitar Hero Aerosmith demo walks this way originally appeared on Joystiq on Mon, 08 Sep 2008 13:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>activisionguitar-heroguitar-hero-aerosmithlive-marketplacemarketplaceneversoftxblmxbox-live-marketplaceMon, 08 Sep 2008 13:00:00 EST<![CDATA[Microsoft E3 2008 press conference: Let's play bingo!]]>http://www.joystiq.com/2008/07/10/microsoft-e3-2008-press-conference-lets-play-bingo/http://www.joystiq.com/2008/07/10/microsoft-e3-2008-press-conference-lets-play-bingo/http://www.joystiq.com/2008/07/10/microsoft-e3-2008-press-conference-lets-play-bingo/#commentsFiled under: , , , ,



XNA Games
Launch Deets
Fable 2
Online Co-op
Alan Wake
Demoed
Secret
Rare Game
60 GIG
Hard Drive

Gears 2
4 player Co-op
Halo
Chronicles
Too Human
XBLM Demo
Rock Band 2
On Stage
Bungie Talks
New Game

Dashboard
Reborn
J Allard
Returns
FREE SPACE
Avatars!
Cliff Appears
With Lancer
Metal Gear
Online

Xbox 360
Price-Cut
'LIPS'
Revealed
Halo Wars
Release Date
Eternal
Darkness 2
Third Party
Xbox 360

Xbox Live
Goes Free
Dishwasher
Released
New
X360 SKU
Motion
Controller
Top Secret
XBLA Games

In anticipation of next week's E3 Media and Business Summit, we've prepared bingo cards for each of the big press conferences, filled with some likely (and some not-so-likely) predictions for what each of the big three console makers intends to announce at arguably the biggest trade shows of the year.

Today's card is for Microsoft (special thanks to X3F). We're going out on a limb and giving Avatars away as the free space. Click on each of the slides above for more information about our predictions. Microsoft's E3 press conference is scheduled for next Monday at 10:30 am PT (that's 1:30 pm Joystiq Time / ET). As always, we'll be liveblogging the event, so you can play along in real-time with us.

Stay tuned for more press conference bingo cards in the days leading up to the conference. (Also: check out our bingo card for Sony's press conference.)

Download a copy (PNG file) and play along!

Update: Only hours after we post this ... N2, you hit my battleship!

JoystiqMicrosoft E3 2008 press conference: Let's play bingo! originally appeared on Joystiq on Thu, 10 Jul 2008 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>avatarsbingobungiecliffybdishwasher-samuraie3e3-2008e3-2008-bingoe3-bingoeternal-darkness-2gears-of-war-2halo-chronicleshalo-warslipsmarketplacemetal-gearmetal-gear-onlinemicrosoftpeter-jacksonrock-band-2too-humanxblaxblmXboxXbox-360xbox-livexbox-live-arcadeThu, 10 Jul 2008 12:00:00 EST<![CDATA[360 Dashboard 2.0 mock-up, is Microsoft listening?]]>http://www.joystiq.com/2008/07/01/360-dashboard-2-0-mock-up-is-microsoft-listening/http://www.joystiq.com/2008/07/01/360-dashboard-2-0-mock-up-is-microsoft-listening/http://www.joystiq.com/2008/07/01/360-dashboard-2-0-mock-up-is-microsoft-listening/#commentsFiled under:


Over at Platform Nation there is a very interesting article about what could be done to improve the Xbox 360 dashboard, thus creating Dashboard 2.0. You can see a mock-up of the Marketplace blade above, including eye-popping images for XBLA games. Even better, the games have user ratings and the prices are listed right on the front page, no need to click through to see how much a game costs. There are a number of other improvements, including the ability to hotkey areas you use often (XBLA, Marketplace, etc). The article goes into detail about where the current dashboard has problems and what can be done to address them (right down to cleaning up completely unused space). It's really a good read and we suggest you check it out. We can only hope that someone at Microsoft is paying attention.

[Thanks Alex Fischer and Gemini Ace. Via Joystiq]

Joystiq360 Dashboard 2.0 mock-up, is Microsoft listening? originally appeared on Joystiq on Tue, 01 Jul 2008 16:45:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>dashdashboarddashboard-2marketplaceplatform-nationxblmxbox-live-marketplaceTue, 01 Jul 2008 16:45:00 EST<![CDATA[Ninja Gaiden II demo out today in Japan, rest of the world 'soon']]>http://www.joystiq.com/2008/05/30/ninja-gaiden-ii-demo-out-today-in-japan-rest-of-the-world-soon/http://www.joystiq.com/2008/05/30/ninja-gaiden-ii-demo-out-today-in-japan-rest-of-the-world-soon/http://www.joystiq.com/2008/05/30/ninja-gaiden-ii-demo-out-today-in-japan-rest-of-the-world-soon/#commentsFiled under: ,

ninja gaiden ii
A demo for the ultra-violent Ninja Gaiden II is due out today for the approximately 14 people in Japan who own an Xbox 360. Chris Paladino of Micorosft's Gamercore blog confirmed the news via NeoGAF earlier this morning, adding, "Looking for details on rest of world, haven't found anything other than 'soon,'" followed by a colon and a capital P.

Since March, the NGII page on Xbox.com had a message that said, "Get your hands on the free demo coming to Xbox LIVE Marketplace in May," but that was quietly removed sometime this week. Ninja Gaiden II will paint the wall with blood in North America and Europe next week.

[Via X3F]

JoystiqNinja Gaiden II demo out today in Japan, rest of the world 'soon' originally appeared on Joystiq on Fri, 30 May 2008 11:25:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>demomarketplaceng2ninja-gaidenninja-gaiden-2ninja-gaiden-iitecmoxblmXbox-360xbox-liveFri, 30 May 2008 11:25:00 EST<![CDATA[Crash Time demo races onto Xbox Live]]>http://www.joystiq.com/2008/05/30/crash-time-demo-races-onto-xbox-live/http://www.joystiq.com/2008/05/30/crash-time-demo-races-onto-xbox-live/http://www.joystiq.com/2008/05/30/crash-time-demo-races-onto-xbox-live/#commentsFiled under: ,

We'll admit it, upon seeing that there was a demo for Crash Time on Xbox Live Marketplace this morning, it was actually the first time we had even heard of the game. It was made by Synetic, a company we've never heard of. It's based on a German TV series that we've also never heard of. Those things in and of themselves don't really mean much though. What we know is that it has cars and, presumably, said cars will crash. That's two points in the game's favor right there. Three points actually, considering the cars can explode. Wait, it also has a cheesy hard rawk soundtrack. That makes for a potential fourth point. Whether or not it's actually any fun is a quandary we'll leave up to you. Go grab it and tell us what you think.

JoystiqCrash Time demo races onto Xbox Live originally appeared on Joystiq on Fri, 30 May 2008 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>crash-timemarketplacertlsyneticxblmxbox-live-marketplaceFri, 30 May 2008 10:30:00 EST<![CDATA[Would You Rather ... Episodic Edition]]>http://www.joystiq.com/2008/05/07/would-you-rather-episodic-edition/http://www.joystiq.com/2008/05/07/would-you-rather-episodic-edition/http://www.joystiq.com/2008/05/07/would-you-rather-episodic-edition/#commentsFiled under: ,


In our continuing effort to bring you fresh and interesting content, X3F presents Would You Rather ... a weekly feature that asks you the hard questions. The point? If you had to choose one or the other, which would you go for?

This week for WUR we're talking episodic content. With games like Penny Arcade: On the Rain-Slick Precipice of Darkness on the horizon for XBLA we're wondering what your opinion is on distribution and pricing.

Assuming that when it's all said and done you'd spend the same amount on an entire season of content, which would you prefer? Purchase an entire season of content for a final total price and download each episode when they are available (akin to one of the purchase models of Sam & Max from GameTap) or purchase each episode/content pack separately like the current Xbox Live Marketplace model?


Feel free to share the reasons for your vote in the comments. We'll share the results of the poll during the next edition of Would You Rather ... which hits X3F every Wednesday.

Last weeks WUR results can be find after the jump ... steal this info!

Continue reading Would You Rather ... Episodic Edition

JoystiqWould You Rather ... Episodic Edition originally appeared on Joystiq on Wed, 07 May 2008 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>gametapmarketplacesubscriptionwurxblmxbox-live-marketplaceWed, 07 May 2008 16:00:00 EST<![CDATA[Joyswag: Win Mass Effect's 'Bring Down the Sky' DLC]]>http://www.joystiq.com/2008/03/10/joyswag-win-mass-effects-bring-down-the-sky-dlc/http://www.joystiq.com/2008/03/10/joyswag-win-mass-effects-bring-down-the-sky-dlc/http://www.joystiq.com/2008/03/10/joyswag-win-mass-effects-bring-down-the-sky-dlc/#commentsFiled under: , ,


We never forget a face. That explains why we nearly overlooked the charming fellow above, as his disturbing assemblage of teeth, eyes and wrinkles really stretches our definition of "face" to its very hideous limit. Apparently, we were supposed to meet him for a round of Mass Effect today, foiling his and his fellow Batarians' plan to toss an asteroid at an unsuspecting planet.

If you feel like your galactic romp across BioWare's rich galaxy is in need of extension, the "Bring Down the Sky" Mass Effect add-on promises "approximately 90 minutes" of gameplay and 50 gamerscore points. It's available on the Xbox Live Marketplace now for $5, or 400 MS Points. Oh, and you can win a download code for it right now.
  • To enter this giveaway, suggest a caption for the above image in the comments section.
  • You must be 18 years or older and a resident of the US or Canada (excluding Quebec).
  • Limit 1 entry per person. If you enter this giveaway more than once you'll be automatically disqualified and jettisoned into space!
  • This entry period ends tomorrow at 5:45pm ET Tuesday 3/11/08. We'll randomly select 10 winners at that time.
  • For complete rules capable of generating extensive dialogue trees, click here.
[Update: The contest is over. We'll be contacting the winners shortly, so please keep an eye on your inbox!]

JoystiqJoyswag: Win Mass Effect's 'Bring Down the Sky' DLC originally appeared on Joystiq on Mon, 10 Mar 2008 17:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>BioWareBreakingNewsBring-Down-the-SkyDLCjoyswagMarketplaceMassEffectXbox-360Xbox-LiveXboxLiveMon, 10 Mar 2008 17:45:00 EST<![CDATA[New gamerpics are a teabag full of insipidness]]>http://www.joystiq.com/2008/03/07/new-gamerpics-are-a-teabag-full-of-insipidness/http://www.joystiq.com/2008/03/07/new-gamerpics-are-a-teabag-full-of-insipidness/http://www.joystiq.com/2008/03/07/new-gamerpics-are-a-teabag-full-of-insipidness/#commentsFiled under: ,


We realize that a lot of crap gets dumped on Xbox Live Marketplace that we don't comment on. We used to notice it more, but mocking it is almost sort of futile now. But when someone sends along a tip to alert us that they've just sullied the Marketplace, we feel compelled to comment on it. So, here it goes. As seen above, Disruptive Media Publishers has just unleashed the "Hardcore Gamer Picture Pack," a name so ironic that Alanis Morissette just beat herself to death with a shoe.

If you pony up the $1.25 for the Hardcore Game Picture Pack, we're officially not friends. We would honestly prefer you to get your Xbox Live Vision camera, and take a picture of your crotch and make it your gamerpic. If you burned a combination orphanage/puppy mill to the ground and dragged a generator to the scene so you could (using the Shroud of Turin as lens filter) take a picture of the flames with your Xbox Live Vision camera and made that your pic, we would be less offended.

OK, we wanted to end on that line, but we had to mention the "Respawn" one. What does that even mean? That you're happy the game continues after you've been killed? Yes! We are too!

JoystiqNew gamerpics are a teabag full of insipidness originally appeared on Joystiq on Fri, 07 Mar 2008 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>gamerpicsmarketplaceXbox-360xbox-livexboxliveFri, 07 Mar 2008 16:30:00 EST<![CDATA[Microsoft toying with the idea of a Games for Windows Marketplace]]>http://www.joystiq.com/2008/03/07/microsoft-toying-with-the-idea-of-a-games-for-windows-marketplac/http://www.joystiq.com/2008/03/07/microsoft-toying-with-the-idea-of-a-games-for-windows-marketplac/http://www.joystiq.com/2008/03/07/microsoft-toying-with-the-idea-of-a-games-for-windows-marketplac/#commentsFiled under: ,

In an interview with Eurogamer, Microsoft's Games for Windows (G4W) senior global manager director Kevin Unangst mentioned that they hope to bring some sort of Xbox Live Marketplace to the G4W platform.

When talking about the possibility of a G4W Marketplace, Unangst said that "you can be confident we want to enable things like digital distribution, the ability to do downloadable content for games - that's a direction we're definitely headed in". He was also clear about the fact that they "don't have anything specific to announce in terms of timeframes right now" regarding a Marketplace or a way to obtain DLC on the G4W platform. It's an interesting and welcomed idea, but wouldn't you think priority number one would be to get more developers on board to support G4W? We think that's where the effort should be focused.

JoystiqMicrosoft toying with the idea of a Games for Windows Marketplace originally appeared on Joystiq on Fri, 07 Mar 2008 11:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>g4wgames-for-windowsmarketplacexblmFri, 07 Mar 2008 11:30:00 EST<![CDATA[Disney Channel programming launches on Live Marketplace]]>http://www.joystiq.com/2008/02/16/disney-channel-content-launches-on-live-marketplace/http://www.joystiq.com/2008/02/16/disney-channel-content-launches-on-live-marketplace/http://www.joystiq.com/2008/02/16/disney-channel-content-launches-on-live-marketplace/#commentsFiled under:


We were planning on accompanying this post with a poll asking how many of our readers regularly watch Hannah Montana, but we're pretty sure we can guess the results of that questionnaire -- half of our readers would fess up to watching the pre-teen pop queen, and the other half would be bold-faced liars.

Fine, you don't have to admit it -- but if you have a friend (wink, wink) with an Xbox Live account, that friend (nudge, nudge) can now download episodes of Hannah Montana as well as a plethora of other Disney channel programming on Live Marketplace. It's just like having that dreamy Zac Efron live inside of your Xbox 360 hard drive, ready to serenade you at your behest, just one ashamed button press away from your Veteran career on Call of Duty 4.

[Via Gamerscore Blog]

JoystiqDisney Channel programming launches on Live Marketplace originally appeared on Joystiq on Sat, 16 Feb 2008 18:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>disneyhannahmontanamarketplacesuitelifeofzackandcodyxblxbox liveXbox-360XboxLiveSat, 16 Feb 2008 18:00:00 EST<![CDATA[ABC Television and MGM brings HD content to Xbox Marketplace]]>http://www.joystiq.com/2008/01/06/abc-television-and-mgm-brings-hd-content-to-xbox-marketplace/http://www.joystiq.com/2008/01/06/abc-television-and-mgm-brings-hd-content-to-xbox-marketplace/http://www.joystiq.com/2008/01/06/abc-television-and-mgm-brings-hd-content-to-xbox-marketplace/#commentsFiled under: ,


At CES today, Microsoft announced an expansion of its Xbox Live video offerings. ABC Television and MGM will both offer HD videos on the Marketplace. Coincidentally, these studios are exclusively aligned to Blu-ray. This agreement gives Xbox owners a chance to experience this content in HD as well.

ABC Television Network, ABC Family, ABC News, Disney Channel and Toon Disney are all part of this new offering. More than 500 hours of content, in both standard definition and high definition, will be offered including ABC Television shows Lost, Grey's Anatomy, Ugly Betty and Desperate Housewives. Past and current shows will be offered, as will archived ABC News broadcasts.

MGM will offer a wide variety of movies, from the Rocky series to Dances with Wolves. Movies across all demographics will be available, including Terminator, Silence of the Lambs, Legally Blonde, Barbershop and Agent Cody Banks. Platoon, Rain Man and The Usual Suspects will also be available.

Price and an exact launch date of this newly announced content have yet to be revealed. HD DVD may have gotten a serious death blow this week, but it appears Microsoft's on-demand offerings should more than satiate the HD film appetite of the Xbox fan.

JoystiqABC Television and MGM brings HD content to Xbox Marketplace originally appeared on Joystiq on Sun, 06 Jan 2008 21:55:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>breakingnewscesdesperate-housewivesgrey's-anatomylegally-blondelostmarketplacemgmrockyterminatorugly-bettyXbox-360xbox-liveSun, 06 Jan 2008 21:55:00 EST<![CDATA[Sensible World of Soccer fixed, back on XBLA]]>http://www.joystiq.com/2007/12/21/sensible-world-of-soccer-fixed-back-on-xbla/http://www.joystiq.com/2007/12/21/sensible-world-of-soccer-fixed-back-on-xbla/http://www.joystiq.com/2007/12/21/sensible-world-of-soccer-fixed-back-on-xbla/#commentsFiled under: ,


After a blatant bug caused it to be yanked from the Xbox Live Marketplace, Sensible World of Soccer has returned sans obvious technical faults. This version of the footy classic still has the problem of us being completely rubbish at it, but we can't lay the blame at the feet of the developers. They'd just boot it into our obviously unguarded net.

If you were enjoying the previous release of Codemasters' kicker despite the creepy crawlies in the code, you're advised to delete the game from your Xbox 360 hard drive and download it again. Major Nelson assures us that you won't be charged if you've already paid for it -- and if not, swos never your concern anyway.

JoystiqSensible World of Soccer fixed, back on XBLA originally appeared on Joystiq on Fri, 21 Dec 2007 16:25:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>CodemastersMarketplaceSensible-World-of-SoccerSensibleWorldofSoccerSoccerswosXBLAXbox-360Fri, 21 Dec 2007 16:25:00 EST<![CDATA[Sensible World of Soccer has critical bug, gets pulled]]>http://www.joystiq.com/2007/12/19/sensible-world-of-soccer-has-critical-bug-gets-pulled/http://www.joystiq.com/2007/12/19/sensible-world-of-soccer-has-critical-bug-gets-pulled/http://www.joystiq.com/2007/12/19/sensible-world-of-soccer-has-critical-bug-gets-pulled/#commentsFiled under: ,

The video just about sums it up. After a long build-up, Sensible World of Soccer rushed onto the Xbox Live Marketplace field this morning and promptly fell on its face. (Thanks to West Ham's Robert Green for the visual aid.) The beloved soccer game apparently suffered from a bug that would sign players out of Live as soon as it started up, and wouldn't sign them back in until they returned to the dashboard. After the forums erupted on Codemasters' official site, the game was pulled from Marketplace.

There's currently no announced timetable for its return, but we'll update this post as soon as we hear something new. In the meantime, Major Nelson has the lowdown on all the "anonymous" information your game will collect on you to present you with the very finest in in-game advertising. ... Once it's working, of course.

[Thanks, GiantHaystax]

JoystiqSensible World of Soccer has critical bug, gets pulled originally appeared on Joystiq on Wed, 19 Dec 2007 08:59:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>codemastersmarketplacesensible-world-of-soccersensibleworldofsoccerswosxblaXbox-360Wed, 19 Dec 2007 08:59:00 EST<![CDATA[Gaze at Halo 3 'Heroic Map Pack' images]]>http://www.joystiq.com/2007/12/06/gaze-at-halo-3-heroic-map-pack-pack-images/http://www.joystiq.com/2007/12/06/gaze-at-halo-3-heroic-map-pack-pack-images/http://www.joystiq.com/2007/12/06/gaze-at-halo-3-heroic-map-pack-pack-images/#commentsFiled under: ,


Be honest now. It's not like you have anything better to do than to stare at a series of polygonal environments and pretend you're dashing through them, mowing down multicolored cyborgs and kidnapping defenseless flags. In the gallery below you'll find images depicting the three environments comprising Halo 3's "Heroic Map Pack," which arrives on the Xbox Live Marketplace on Dec. 11th. It'll set you back 800 MS Points ($10) unless you're the patient and/or apathetic type, in which case it'll cost you nothing early next year. But then, we already lost the apathetic readers at the headline.

If you've made it this far (kudos to you for putting up with an unreasonable amount of filler nonsense), you'll want to be reminded about those three new maps again: "Rat's Nest," an indoor area rife with vehicles! "Standoff," a valley overshadowed by a large melancholy dish who's always staring off into space! "Foundry," a level you get to strategically clutter up (sometimes with soccer balls) in Forge! The constant use of exclamation marks is unnecessary and annoying!

Gallery: Halo 3 - Heroic Map Pack



[Via X3F]

JoystiqGaze at Halo 3 'Heroic Map Pack' images originally appeared on Joystiq on Thu, 06 Dec 2007 20:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>BungieDLCFPSHaloHalo3Heroic-Map-PackMarketplaceXbox-360XboxLiveThu, 06 Dec 2007 20:30:00 EST<![CDATA[Katamari demo rolls up (get it?!) Marketplace]]>http://www.joystiq.com/2007/08/14/katamari-demo-rolls-up-get-it-marketplace/http://www.joystiq.com/2007/08/14/katamari-demo-rolls-up-get-it-marketplace/http://www.joystiq.com/2007/08/14/katamari-demo-rolls-up-get-it-marketplace/#commentsFiled under: ,


Beautiful Katamari's demo just landed on Marketplace and has been rolling up a storm. At first, it was available on a recent OXM demo disc, but now it is available for the whole world Canada, America, and Mexico (read: North America) to download. It weighs in at just under 435 MB, so it's not going to break the disk space bank, although X3F reader Magic Whiskey tells us that it's also on the short side, but enough to get the premise of the game. Give it a download and tell us what you think.

JoystiqKatamari demo rolls up (get it?!) Marketplace originally appeared on Joystiq on Tue, 14 Aug 2007 10:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>Beautiful KatamariBeautifulKatamariKatamariMarketplaceXBLMTue, 14 Aug 2007 10:00:00 EST