Joystiq http://www.joystiq.com Joystiq http://www.blogsmithmedia.com/http://www.joystiq.com/media/feedlogo.gif Joystiq http://www.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Superbot 'substantially' smaller after Sony split, working on new IP]]>http://www.joystiq.com/2013/04/15/superbot-substantially-smaller-after-sony-split-working-on-ne/http://www.joystiq.com/2013/04/15/superbot-substantially-smaller-after-sony-split-working-on-ne/http://www.joystiq.com/2013/04/15/superbot-substantially-smaller-after-sony-split-working-on-ne/#comments Superbot, the developer behind PlayStation All-Stars Battle Royale, is a smaller studio following its split with Sony earlier this year, which saw the Culver City-based outfit make a number of positions redundant. Its next step is to work on a new property.

"We have substantially shrunk down our operations but are still going strong while we work on a new IP," director of operations David Yang told Edge.

Superbot was formed in 2009 as Broodworks, a studio focusing on developing video games for Sony handhelds. The studio was later renamed Superbot Entertainment and made its debut with PlayStation All-Stars.

JoystiqSuperbot 'substantially' smaller after Sony split, working on new IP originally appeared on Joystiq on Mon, 15 Apr 2013 22:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>david-yangplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3sceasuperbotsuperbot-entertainmentvitaMon, 15 Apr 2013 22:45:00 EST<![CDATA[See Zeus, Isaac Clarke throw down in PlayStation All-Stars]]>http://www.joystiq.com/2013/02/28/see-zeus-isaac-clarke-throw-down-in-playstation-all-stars/http://www.joystiq.com/2013/02/28/see-zeus-isaac-clarke-throw-down-in-playstation-all-stars/http://www.joystiq.com/2013/02/28/see-zeus-isaac-clarke-throw-down-in-playstation-all-stars/#comments
Sony will release downloadable characters Zeus and Isaac Clarke for PlayStation All-Stars: Battle Royale on March 19, along with a new stage that is a cross-over of MediEvil and The Unfinished Swan. According to a post on the PlayStation Blog from newly appointed Sony lead game designer Seth Killian, the stage will be free to play in online ranked matches, $1.99 to own.

Both Zeus and Isaac are being offered gratis to those who purchase God of War: Ascension, available through an included voucher; or you can buy each combatant for $4.99 through PSN on March 19. Above, you can see Isaac battle back the madness - hop past the break if you want to see Zeus choke Sackboy.

Gallery: PlayStation All-Stars: Battle Royale (Zeus and Isaac Clarke DLC)

Continue reading See Zeus, Isaac Clarke throw down in PlayStation All-Stars

JoystiqSee Zeus, Isaac Clarke throw down in PlayStation All-Stars originally appeared on Joystiq on Thu, 28 Feb 2013 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dead-spacedead-space-2dead-space-3dlceagod-of-wargod-of-war-ascensionisaac-clarkemedievilplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3sceasuperbot-entertainmentthe-unfinished-swanvisceral-gamesvitazeusThu, 28 Feb 2013 19:00:00 EST<![CDATA[PSA: PlayStation All-Stars get Kat and Emmett Graves today, free for 2 weeks]]>http://www.joystiq.com/2013/02/12/psa-playstation-all-stars-get-kat-and-emmett-graves-today-free/http://www.joystiq.com/2013/02/12/psa-playstation-all-stars-get-kat-and-emmett-graves-today-free/http://www.joystiq.com/2013/02/12/psa-playstation-all-stars-get-kat-and-emmett-graves-today-free/#comments
PlayStation All-Stars: Battle Royale gets an infusion of fresh blood today with the addition of two more classic Sony mascots. First up is Kat, star of last June's Gravity Rush. Next is Emmett Graves, grizzled protagonist of Starhawk, who comes to us all the way from last May.

Okay, so maybe developer Superbot didn't dig too deep into the Sony library for these two, but the good news is that they're both completely free for the next two weeks. After that, they're $4.99 each.

Continue reading PSA: PlayStation All-Stars get Kat and Emmett Graves today, free for 2 weeks

JoystiqPSA: PlayStation All-Stars get Kat and Emmett Graves today, free for 2 weeks originally appeared on Joystiq on Tue, 12 Feb 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-vitaps3superbot-entertainmentvitaTue, 12 Feb 2013 18:00:00 EST<![CDATA[Sony and Superbot part ways, Superbot 'excited' about its future]]>http://www.joystiq.com/2013/02/04/sony-and-superbot-part-ways-superbot-excited-about-its-future/http://www.joystiq.com/2013/02/04/sony-and-superbot-part-ways-superbot-excited-about-its-future/http://www.joystiq.com/2013/02/04/sony-and-superbot-part-ways-superbot-excited-about-its-future/#comments HIT 1ST Sony and Superbot part ways, all future PS AllStars DLC done internallySony and Superbot Entertainment, the developer behind PS3 and Vita brawler PlayStation All-Stars Battle Royale, are no longer an item. Sony confirms in a statement to Kotaku that its business relationship with Superbot is over:

"Sony Computer Entertainment can confirm that the working agreement with developer Superbot Entertainment has amicably ended. We have had a positive working relationship with this talented studio, and wish them the best of success in their next endeavor. PlayStation All-Stars: Battle Royale and the title's forthcoming DLC releases will continue to be fully supported by Santa Monica Studio."

Superbot's director of operations David Yang provides a statement on the split, noting that the studio doesn't have plans to reduce its staff now, but that could change soon. "It is unlikely we can continue with our current work force for an extended period of time," Yang says. "We are still working things out and hope to continue on with as many of us as possible."

Superbot's complete statement reads as follows:

"Superbot Entertainment can confirm that the relationship with SCEA has ended on good terms. We are extremely grateful to have had the opportunity to work on with Sony on Playstation All-Stars Battle Royale, and are extremely proud of the work we have done. Superbot Entertainment will continue working on projects that reflect our passion for games and our commitment to creating award winning titles. We are very excited about beginning the next chapter of our future and invite all of our fans and supporters to follow our journey."

On January 25, Sony confirmed layoffs at Superbot and promised to support any future All-Stars DLC. A character pack for Battle Royale including Gravity Rush's Kat and Starhawk's Emmett Graves is due on February 12.

JoystiqSony and Superbot part ways, Superbot 'excited' about its future originally appeared on Joystiq on Mon, 04 Feb 2013 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-vitaps3SCEASONYsony-santa-monicasuperbot-entertainmentvitaMon, 04 Feb 2013 17:30:00 EST<![CDATA[PS All-Stars dev SuperBot lays off unknown number of employees]]>http://www.joystiq.com/2013/01/25/report-ps-all-stars-dev-superbot-hit-with-layoffs/http://www.joystiq.com/2013/01/25/report-ps-all-stars-dev-superbot-hit-with-layoffs/http://www.joystiq.com/2013/01/25/report-ps-all-stars-dev-superbot-hit-with-layoffs/#comments Superbot Entertainment, the Sony-owned developer responsible for PlayStation All-Stars Battle Royale, has suffered layoffs today, IGN reports.

"SCEA can confirm that SuperBot Entertainment did make a reduction in their workforce today," a Sony representative told IGN. "The studio and SCEA remain committed to supporting PlayStation All-Stars Battle Royale post launch, including developing the title's forthcoming DLC releases in the coming months."

Currently, the number of employees affected by the downsizing remains unknown, though we have reached out to both Sony and Superbot for more information about the situation and will update as details become available.

Update: Sony has confirmed to us that layoffs have indeed hit Superbot, though no further information was given. Its full statement on the matter can be found after the break.

Continue reading PS All-Stars dev SuperBot lays off unknown number of employees

JoystiqPS All-Stars dev SuperBot lays off unknown number of employees originally appeared on Joystiq on Fri, 25 Jan 2013 18:50:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>downsizinglayoffsplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3SCEASony-Computer-Entertainment-Americasuperbotsuperbot-entertainmentvitaFri, 25 Jan 2013 18:50:00 EST<![CDATA[Kat, Emmett join PlayStation All-Stars Battle Royale Feb. 12]]>http://www.joystiq.com/2013/01/18/kat-emmett-join-playstation-all-stars-battle-royale-feb-12/http://www.joystiq.com/2013/01/18/kat-emmett-join-playstation-all-stars-battle-royale-feb-12/http://www.joystiq.com/2013/01/18/kat-emmett-join-playstation-all-stars-battle-royale-feb-12/#comments
Gravity Rush's Kat and Starhawk's Emmett Graves will be joining the fray as PlayStation All-Stars Battle Royale's first DLC characters on February 12, Sony has announced. Both characters will be free for their first two weeks of availability, though their price point after the fact remains unknown.

As we learned during their initial reveal last December, both characters make heavy usage of the abilities their own games are based on, with Kat (above) manipulating gravity and Emmett summoning mining equipment, as seen after the break. Both characters sport the same amenities as the original cast: extra costumes, full arcade stories and trial modes, etc.

The previously announced Heavenly Sword/Wipeout stage has also been slated for February, though a specific release date or price was not provided. We're still holding out for a ship from Wipeout as a playable character.

Continue reading Kat, Emmett join PlayStation All-Stars Battle Royale Feb. 12

JoystiqKat, Emmett join PlayStation All-Stars Battle Royale Feb. 12 originally appeared on Joystiq on Fri, 18 Jan 2013 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>emmett-gravesgravity-rushkatplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3release-dateSCEASony-Computer-Entertainment-Americastarhawksuperbot-entertainmentvitaFri, 18 Jan 2013 16:30:00 EST<![CDATA[PlayStation All-Stars adding Kat and Emmett Graves, plus Heavenly Sword/Wipeout level]]>http://www.joystiq.com/2012/12/04/playstation-all-stars-adding-kat-and-emmett-graves-plus-heavenl/http://www.joystiq.com/2012/12/04/playstation-all-stars-adding-kat-and-emmett-graves-plus-heavenl/http://www.joystiq.com/2012/12/04/playstation-all-stars-adding-kat-and-emmett-graves-plus-heavenl/#comments PlayStation AllStars gets Kat and Emmett Graves, along with a Heavenly SwordWipeout levelSuperBot Entertainment showed off a new pair of fighters in PlayStation All-Stars Battle Royale at the Sony Santa Monica studio recently: Kat from Gravity Rush and Emmett Graves from Starhawk will be the first two DLC characters to join the fracas. The character pack containing both will be free for a limited time when it arrives sometime early next year.

SuperBot's director Omar Kendall also premiered a brand new level for the game, combining the worlds of Heavenly Sword and Wipeout into a beautiful but precarious environment. The actual pricing (and release date) for the level hasn't yet been decided.

While letting us play a little bit with each character, Kendall talked to us about the reaction to PlayStation All-Stars, why these two characters are the first to make the DLC cut, and what else SuperBot has planned.

Gallery: PlayStation All-Stars Battle Royale: Kat and Emmett Graves

Continue reading PlayStation All-Stars adding Kat and Emmett Graves, plus Heavenly Sword/Wipeout level

JoystiqPlayStation All-Stars adding Kat and Emmett Graves, plus Heavenly Sword/Wipeout level originally appeared on Joystiq on Tue, 04 Dec 2012 08:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>charactersdlcemmett-gravesheavenly-swordinterviewkatomar-kendallplaystationplaystation-all-stars-battle-royaleplaystation-vitaps-all-starsps3sony-santa-monicasuperbot-entertainmentvitaTue, 04 Dec 2012 08:30:00 EST<![CDATA[PlayStation All-Stars: Battle Royale review: Smashing]]>http://www.joystiq.com/2012/11/21/playstation-all-stars-battle-royale-review/http://www.joystiq.com/2012/11/21/playstation-all-stars-battle-royale-review/http://www.joystiq.com/2012/11/21/playstation-all-stars-battle-royale-review/#comments Nintendo's presence looms large in the fledgling category of game mascot fighters. For years, the company has had a monopoly on the concept with its Smash Bros. series, essentially making it a genre of one. Sony may be the only other publisher with a large enough bench to support such a concept, and as a result PlayStation All-Stars: Battle Royale has been subject to many comparisons with Nintendo's beloved franchise (not all of them favorable).

All-Stars certainly wears its influences on its sleeve, but thanks to some clever ideas, it also earns its keep. This isn't just a carbon copy, but a well-designed game that could go toe-to-toe with Nintendo's fighters.

Gallery: PlayStation All-Stars: Battle Royale (11/20/12)

Continue reading PlayStation All-Stars: Battle Royale review: Smashing

JoystiqPlayStation All-Stars: Battle Royale review: Smashing originally appeared on Joystiq on Wed, 21 Nov 2012 16:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-vitaps3santa-monica-studiosceasonysony-santa-monicasuperbot-entertainmentvitaWed, 21 Nov 2012 16:15:00 EST<![CDATA[PS All-Stars Battle Royale live-action TV ad, the European take]]>http://www.joystiq.com/2012/11/06/ps-all-stars-battle-royale-live-action-tv-ad-the-european-take/http://www.joystiq.com/2012/11/06/ps-all-stars-battle-royale-live-action-tv-ad-the-european-take/http://www.joystiq.com/2012/11/06/ps-all-stars-battle-royale-live-action-tv-ad-the-european-take/#comments
This European TV ad for PlayStation All-Stars Battle Royale is an interesting take on the live-action vid rolled out by Sony last month. The guy supposed to be Drake looks like the one person who didn't dress up at a Halloween party.

JoystiqPS All-Stars Battle Royale live-action TV ad, the European take originally appeared on Joystiq on Tue, 06 Nov 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bluepoint-gamesplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3sonysony-santa-monicasuperbot-entertainmentvitaTue, 06 Nov 2012 10:30:00 EST<![CDATA[All-Stars Battle Royale ad sees PlayStation heroes fight in live action]]>http://www.joystiq.com/2012/10/23/all-stars-battle-royale-ad-sees-playstation-heroes-fight-in-live/http://www.joystiq.com/2012/10/23/all-stars-battle-royale-ad-sees-playstation-heroes-fight-in-live/http://www.joystiq.com/2012/10/23/all-stars-battle-royale-ad-sees-playstation-heroes-fight-in-live/#comments
When you think about it, this was a predictable step from the creators of last year's "Michael' commercial for PS3. After successfully expressing the thoughts of live-action PlayStation characters, this ad for PS All-Stars Battle Royale shows the time for talking is over. Maybe because the budget was blown on fancy special effects; Nolan North doesn't come cheap, you know.

Though it doesn't quite match the brilliance of last year's ad, it's another imaginative and fun effort for what will hopefully be a game with similar qualities. On a side note, live-action ads seem to be the rage at the moment. Last week Need for Speed: Most Wanted and Halo 4 got their real on, and now All-Stars Battle Royale follows suit. If only Nintendo would join the club.

JoystiqAll-Stars Battle Royale ad sees PlayStation heroes fight in live action originally appeared on Joystiq on Tue, 23 Oct 2012 08:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bluepoint-gamescole-mcgrathkratosnathan-drakeplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3sackboysuperbot-entertainmentvitaTue, 23 Oct 2012 08:00:00 EST<![CDATA[PlayStation All-Stars: Battle Royale brings the party to iam8bit this week]]>http://www.joystiq.com/2012/10/21/playstation-all-stars-battle-royale-brings-the-party-to-iam8bit/http://www.joystiq.com/2012/10/21/playstation-all-stars-battle-royale-brings-the-party-to-iam8bit/http://www.joystiq.com/2012/10/21/playstation-all-stars-battle-royale-brings-the-party-to-iam8bit/#comments iam8bit's PlayStation AllStars event in LALos Angeles' trendy video game art house iam8bit is hosting a one-night event for PlayStation All-Stars: Battle Royale, with the final release code playable for the first time in public. The event is dubbed the LA Beatdown, and it takes place on Wednesday, October 24 from 7 p.m. - 11 p.m. at this location.

LA Beatdown is completely free to enter and includes the following goodies: the game playable on a 25-foot widescreen; exclusive, one-time-print t-shirts and posters with art by Boneface for the first 500 attendees (check out the design above); a museum-style exhibit featuring characteristic items from each Battle Royale character; a photo stage with props from the game; and complimentary alcoholic beverages for those 21 and older. Vizzi food truck will be parked outside as well.

Entrance is first-come, first-serve, so if you're in the LA area start planning for a thumpin' hump day now.

JoystiqPlayStation All-Stars: Battle Royale brings the party to iam8bit this week originally appeared on Joystiq on Sun, 21 Oct 2012 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>IAm8bitlos-angelespartyplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3SONYsuperbot-entertainmentvitaSun, 21 Oct 2012 13:30:00 EST<![CDATA[PlayStation All-Stars features writing by Ken Levine]]>http://www.joystiq.com/2012/10/04/playstation-all-stars-features-writing-by-ken-levine/http://www.joystiq.com/2012/10/04/playstation-all-stars-features-writing-by-ken-levine/http://www.joystiq.com/2012/10/04/playstation-all-stars-features-writing-by-ken-levine/#comments PlayStation AllStars features writing by Ken LevineThe PlayStation All-Stars: Battle Royale team has been very careful to treat the game's many franchises with respect, said director Omar Kendall in an interview with Polygon. "We take this very seriously, and sometimes the IP holders know best, and obviously we want to present the characters in the best way for the developers and the fans," he said, after noting that Irrational creative director Ken Levine wrote the dialogue for the Big Daddy / Little Sister character. According to Kendall, Levine "wrote every line of script and dialogue" for the pair.

The same care went into every character, with each studio getting "complete, 100 percent approval" on its characters, he said. That includes characters owned by Sony studios, like Nathan Drake, the star of Naughty Dog's Uncharted series.

As for Levine's script, we're presuming it includes several instances of "Mr. Bubbles" and "MMMRRUUUNGGHHH!"

JoystiqPlayStation All-Stars features writing by Ken Levine originally appeared on Joystiq on Thu, 04 Oct 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>ken-levineplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3superbot-entertainmentvitaThu, 04 Oct 2012 14:30:00 EST<![CDATA[Rumor: Gravity Rush's Kat in PlayStation All-Stars: Battle Royale]]>http://www.joystiq.com/2012/09/08/rumor-gravity-rushs-kat-in-playstation-all-stars-battle-royal/http://www.joystiq.com/2012/09/08/rumor-gravity-rushs-kat-in-playstation-all-stars-battle-royal/http://www.joystiq.com/2012/09/08/rumor-gravity-rushs-kat-in-playstation-all-stars-battle-royal/#comments Rumor Gravity Rush's Kat in PlayStation AllStars Battle RoyaleThere isn't a lot to go on with this latest PlayStation All-Stars: Battle Royale character rumor, but if we've learned anything from the last few, it's that we should probably pay attention to leaks and speculation.

The above picture (full-sized and uncropped here) appears to show the PlayStation All-Stars character bio of Kat of Gravity Rush fame. The style is consistent with the official site's existing bios, but we were unable to locate Kat's bio ourselves through clever URL manipulations or otherwise. For now, we're keeping this in the "maybe" pile, but we'll also keep our ear to the ground and will update with any new information that surfaces.

JoystiqRumor: Gravity Rush's Kat in PlayStation All-Stars: Battle Royale originally appeared on Joystiq on Sat, 08 Sep 2012 12:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Gravity-RushKatplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3sony-santa-monicasuperbot-entertainmentvitaSat, 08 Sep 2012 12:00:00 EST<![CDATA[Nariko and Fortesque confirmed for PlayStation All-Stars [update]]]>http://www.joystiq.com/2012/08/30/nariko-and-fortesque-confirmed-for-playstation-all-stars/http://www.joystiq.com/2012/08/30/nariko-and-fortesque-confirmed-for-playstation-all-stars/http://www.joystiq.com/2012/08/30/nariko-and-fortesque-confirmed-for-playstation-all-stars/#comments Nariko and Fortesque confirmed for PlayStation AllStars
Two more characters have been announced as members of the PlayStation All-Stars: Battle Royale roster, both of which attach firmly to either side of the "deep cut" spectrum: Nariko of Heavenly Sword fame, and MediEvil's Sir Daniel Fortesque.

As has been the case with the last few All-Stars character reveals, both Nariko and Fortesque were originally rumored a few weeks ago when files pulled from the beta found their way to neoGAF. Nariko's fighting style is described as "high risk, high reward" by designer Seth Killian in the video above, while Fortesque is said to be much slower and more methodical. Both characters, however, use weapons culled from the annals of their respective series' history.

Update: The video originally embedded above, belonging to Gamespot, has been set to private. We have replaced the video with a mirror located here and have updated this post's source link to reflect that change.

JoystiqNariko and Fortesque confirmed for PlayStation All-Stars [update] originally appeared on Joystiq on Thu, 30 Aug 2012 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fortesqueheavenly-swordmedievilnarikoplaystationplaystation-all-stars-battle-royaleps3SCEAsir-daniel-fortesqueSony-Computer-Entertainment-Americasuperbot-entertainmentThu, 30 Aug 2012 16:30:00 EST<![CDATA[PlayStation All-Stars public beta now accepting applications]]>http://www.joystiq.com/2012/08/29/playstation-all-stars-public-beta-now-accepting-applications/http://www.joystiq.com/2012/08/29/playstation-all-stars-public-beta-now-accepting-applications/http://www.joystiq.com/2012/08/29/playstation-all-stars-public-beta-now-accepting-applications/#comments PlayStation All Stars public beta now accepting applicationsThe PlayStation All-Stars Battle Royale public beta starts on September 11, lasting one week to September 18. Anyone interested in being a part of the frantic action can sign up on the PSN beta site right now.

Players chosen will be notified via email, get a voucher code for the download on either PS3 or the PS Vita, and receive "test night information." Presumably, developer SuperBot will aim to test specific heroes, modes, or stages, so it'll direct players that way.

If you don't make this early cut, you'll have to wait until the full game arrives on November 20.

JoystiqPlayStation All-Stars public beta now accepting applications originally appeared on Joystiq on Wed, 29 Aug 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>betafightinginformationplaystation-all-stars-battle-royaleps-all-starspublicpublic-betasuperbotsuperbot-entertainmenttesttestersvoucherWed, 29 Aug 2012 21:00:00 EST<![CDATA[Metal Gear's Raiden cutting into PlayStation All-Stars Battle Royale roster [Update: Video]]]>http://www.joystiq.com/2012/08/29/metal-gear-raiden-joins-cast-of-playstation-all-stars/http://www.joystiq.com/2012/08/29/metal-gear-raiden-joins-cast-of-playstation-all-stars/http://www.joystiq.com/2012/08/29/metal-gear-raiden-joins-cast-of-playstation-all-stars/#comments
Raiden joins the cast of PlayStation AllStars
Raiden from the Metal Gear Solid series is officially in PlayStation All-Stars Battle Royale. Lead game designer Seth Killian shows off Raiden in a video on Gamespot.

Raiden's strength lies in one-on-one attacks and air combos, and his level 3 super involves trapping all of the other players under boxes for easy pickings. Characters in All-Stars generally have about two dozen moves, but with his combo chains, Raiden has three or four dozen, Killian says.

We first heard rumblings about Raiden in All-Stars back in July, alongside a major character leak.

Update: We've added the official trailer showing off Raiden's slick moves, just up there.

JoystiqMetal Gear's Raiden cutting into PlayStation All-Stars Battle Royale roster [Update: Video] originally appeared on Joystiq on Wed, 29 Aug 2012 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>konamimetal-gear-solidMGSplaystationplaystation-all-stars-battle-royaleps3raidensuperbotsuperbot-entertainmentWed, 29 Aug 2012 12:30:00 EST<![CDATA[Shocker: Evil Cole McGrath is in PlayStation All-Stars]]>http://www.joystiq.com/2012/08/28/shocker-evil-cole-mcgrath-is-in-playstation-all-stars/http://www.joystiq.com/2012/08/28/shocker-evil-cole-mcgrath-is-in-playstation-all-stars/http://www.joystiq.com/2012/08/28/shocker-evil-cole-mcgrath-is-in-playstation-all-stars/#comments Shocker Evil Cole McGrath is in PlayStation AllStars
The latest "new" character to be revealed for PlayStation All-Stars: Battle Royale is Evil Cole McGrath. Based on the trailer, he looks a lot like regular Cole McGrath, who also happens to be playable. The big difference: Evil Cole is eviler. Seriously, dude's a jerk.

JoystiqShocker: Evil Cole McGrath is in PlayStation All-Stars originally appeared on Joystiq on Tue, 28 Aug 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-vitaps3superbot-entertainmentvitaTue, 28 Aug 2012 18:00:00 EST<![CDATA[Dante, Sackboy, Ratchet, Clank and Spike join PlayStation All-Stars' roster [Update: Now with trailers]]]>http://www.joystiq.com/2012/08/14/dante-sackboy-ratchet-clank-and-spike-join-playstation-all-st/http://www.joystiq.com/2012/08/14/dante-sackboy-ratchet-clank-and-spike-join-playstation-all-st/http://www.joystiq.com/2012/08/14/dante-sackboy-ratchet-clank-and-spike-join-playstation-all-st/#comments Dante, Sackboy, Ratchet, Clank and Spike join PlayStation AllStars' roster
DmC's Dante, LittleBigPlanet's Sackboy, Ratchet and Clank's, well, Ratchet and Clank, and Ape Escape's Spike have just been revealed as playable characters in PlayStation All-Stars: Battle Royale during Sony's Gamescom press conference in Germany.

All five four of these characters - Ratchet and Clank fight as one - were included in that leaked character roster we posted near the end of last month, which gives us hope that the other "unannounced" characters listed (Nariko, Raiden, Sir Daniel Fortesque, etc) may in fact be totes legit. The game will launch for PlayStation 3 and Vita in November, but people with both systems will only need to buy it once.

Update: Trailers for each new character have been added beyond the veil.

Continue reading Dante, Sackboy, Ratchet, Clank and Spike join PlayStation All-Stars' roster [Update: Now with trailers]

JoystiqDante, Sackboy, Ratchet, Clank and Spike join PlayStation All-Stars' roster [Update: Now with trailers] originally appeared on Joystiq on Tue, 14 Aug 2012 13:16:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>gamescom-2012playstationplaystation-all-stars-battle-royaleplaystation-vitaps3SCEASony-Computer-Entertainmentsuperbot-entertainmentvitaTue, 14 Aug 2012 13:16:00 EST<![CDATA[PlayStation All-Stars: Battle Royale videos school us on Sly, Fat Princess and more]]>http://www.joystiq.com/2012/08/11/playstation-all-stars-battle-royale-videos-school-us-on-sly-fa/http://www.joystiq.com/2012/08/11/playstation-all-stars-battle-royale-videos-school-us-on-sly-fa/http://www.joystiq.com/2012/08/11/playstation-all-stars-battle-royale-videos-school-us-on-sly-fa/#comments
Sony has unleashed several strategy videos for specific characters in PlayStation All-Stars: Battle Royale, highlighting moves and tips for Kratos, Parappa, Sly Cooper and more.

Continue reading PlayStation All-Stars: Battle Royale videos school us on Sly, Fat Princess and more

JoystiqPlayStation All-Stars: Battle Royale videos school us on Sly, Fat Princess and more originally appeared on Joystiq on Sat, 11 Aug 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-vitaps3SCEASony-Computer-Entertainmentsuperbot-entertainmentvitaSat, 11 Aug 2012 10:30:00 EST<![CDATA[PlayStation All-Stars: Battle Royale lets fight sticks compete on PS3]]>http://www.joystiq.com/2012/08/08/playstation-all-stars-battle-royale-lets-fight-sticks-compete-o/http://www.joystiq.com/2012/08/08/playstation-all-stars-battle-royale-lets-fight-sticks-compete-o/http://www.joystiq.com/2012/08/08/playstation-all-stars-battle-royale-lets-fight-sticks-compete-o/#comments Everyone knows the elegant weapon for a more civilized age is the fight stick, the tried-and-true sidearm of every fighting game fan the world over. And so SuperBot Entertainment announced on Facebook today that the PS3 version of PlayStation All-Stars: Battle Royale will support fight stick peripherals.

"Fans of the fighting game genre can use their favorite arcade-style controller to play Battle Royale to full effect," the Facebook post mentions. "Every attack, combo, and strategy that can be performed on the DualShock 3 controller is seamlessly mapped to arcade button layouts."

Actually, there is one difference between using the fight stick and DualShock 3 - throwing. On the DualShock 3, the move is done using the right analog stick; on a fight stick, it'll be "an easy button combination, similar to many traditional fighting games."

JoystiqPlayStation All-Stars: Battle Royale lets fight sticks compete on PS3 originally appeared on Joystiq on Wed, 08 Aug 2012 00:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fight-stickplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3superbot-entertainmentvitaWed, 08 Aug 2012 00:30:00 EST<![CDATA[Rumor: PlayStation All-Stars characters and stages leak all over the place [Update]]]>http://www.joystiq.com/2012/07/29/rumor-playstation-all-stars-characters-and-stages-leak-all-over/http://www.joystiq.com/2012/07/29/rumor-playstation-all-stars-characters-and-stages-leak-all-over/http://www.joystiq.com/2012/07/29/rumor-playstation-all-stars-characters-and-stages-leak-all-over/#comments Rumor PlayStation AllStars characters and stages leak all over the placeA slew of images reportedly pulled from a private beta of PlayStation All-Stars: Battle Royale shows off many of the game's characters and stages. An original image posted by Reddit user 696Ly is a leak in the truest sense of the word, as the word "leak" is written all over the picture (seen here).

More visible images of 14 stages and 12 characters from the game were posted online by NeoGAF user miladesn. The images appear to be pulled from the game's stage and character select screens, including the BioShock Infinite-inspired "Columbia" stage seen above. We've reached out to Sony for confirmation.

Update: The files pulled from the beta version of the game and posted to the thread on NeoGAF indicate that some of the characters listed may be unlockable. Additionally, one file name lists an evil version of Cole McGrath from the inFamous series as playable, who is also shown in the leaked character images.

The characters in the leaked images are:
Based on the leaked file information, the following characters are also listed as playable:

JoystiqRumor: PlayStation All-Stars characters and stages leak all over the place [Update] originally appeared on Joystiq on Sun, 29 Jul 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationPlayStation-All-Starsplaystation-all-stars-battle-royaleplaystation-vitaps-all-starsps3SCEASONYSony-Computer-Entertainment-Americasuperbotsuperbot-entertainmentvitaSun, 29 Jul 2012 18:00:00 EST<![CDATA[Cole McGrath, Jak and Daxter added to PlayStation All-Stars: Battle Royale roster [Update: Now with trailers!]]]>http://www.joystiq.com/2012/07/15/xxx-and-xxx-added-to-playstation-all-stars-battle-royale-roster/http://www.joystiq.com/2012/07/15/xxx-and-xxx-added-to-playstation-all-stars-battle-royale-roster/http://www.joystiq.com/2012/07/15/xxx-and-xxx-added-to-playstation-all-stars-battle-royale-roster/#comments Cole McGrath, Jak and Daxter added to PlayStation AllStars Battle Royale roster
Cole McGrath of Infamous fame and Jak and Daxter of, well, Jak and Daxter fame were just revealed as the two latest additions to the PlayStation All-Stars: Battle Royale cast during a panel at SDCC.

As seen in the announcement trailer above, Jak and Daxter will function as a pair of characters working in tandem and controlled by one player, sort of like Ice Climbers in Smash Bros. Jak will utilize signature weapons from his series, such as the Gyro Burster and Mass Inverter, and also has the ability to transform into Dark or Light Jax. Daxter will lend a hand with melee attacks, and probably provide moral support. Meanwhile, McGrath's move list is predictably lightning oriented.

Head on past the break for two more trailers showcasing the new characters.

Continue reading Cole McGrath, Jak and Daxter added to PlayStation All-Stars: Battle Royale roster [Update: Now with trailers!]

JoystiqCole McGrath, Jak and Daxter added to PlayStation All-Stars: Battle Royale roster [Update: Now with trailers!] originally appeared on Joystiq on Sun, 15 Jul 2012 14:25:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>cole-mcgrathcomic-con-2012jak-and-daxterplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3SCEAsdcc-2012Sony-Computer-Entertainment-Americasuperbot-entertainmentvitaSun, 15 Jul 2012 14:25:00 EST<![CDATA[PlayStation All-Stars' combo system is more Marvel than Smash Bros.]]>http://www.joystiq.com/2012/07/15/playstation-all-stars-combo-system-is-more-marvel-than-smash-br/http://www.joystiq.com/2012/07/15/playstation-all-stars-combo-system-is-more-marvel-than-smash-br/http://www.joystiq.com/2012/07/15/playstation-all-stars-combo-system-is-more-marvel-than-smash-br/#comments
PlayStation All-Stars: Battle Royale faces an interesting challenge in ingratiating itself to the patently skeptical fighting game world, as not only is it a brand new IP, but it's also a four-player brawler, rather than a "traditional" 2D or 3D fighter.

The game's combo system, however, has more in common with Ultimate Marvel vs. Capcom 3 than it does any iteration of the Super Smash Bros. series, as is evident by the trailer above. Speaking personally, we love the idea of legitimate combos in a brawler setting, but we're also worried about keeping track of something that complicated during a fully-zoomed four-player fight. What if we get confused and do a forward quarter-circle instead of a backward quarter-circle? How embarrassing.

JoystiqPlayStation All-Stars' combo system is more Marvel than Smash Bros. originally appeared on Joystiq on Sun, 15 Jul 2012 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>combo-systemcomboscomic-con-2012playstationplaystation-all-stars-battle-royaleplaystation-vitaps3SCEASDCC-2012Sony-Computer-Entertainment-Americasuperbot-entertainmentvitaSun, 15 Jul 2012 13:30:00 EST<![CDATA[PlayStation All-Stars Battle Royale visits Master Onion in latest clip]]>http://www.joystiq.com/2012/07/10/playstation-all-stars-battle-royale-visits-master-onion-in-lates/http://www.joystiq.com/2012/07/10/playstation-all-stars-battle-royale-visits-master-onion-in-lates/http://www.joystiq.com/2012/07/10/playstation-all-stars-battle-royale-visits-master-onion-in-lates/#comments PlayStation AllStars Battle Royale visits Master Onion in latest clip
You should watch this new trailer for PlayStation All-Stars Battle Royale now. Seriously, chop-chop.

Gallery: PlayStation All-Stars: Battle Royale

JoystiqPlayStation All-Stars Battle Royale visits Master Onion in latest clip originally appeared on Joystiq on Tue, 10 Jul 2012 00:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-vitaps3superbot-entertainmentvitaTue, 10 Jul 2012 00:30:00 EST<![CDATA[PlayStation All-Stars joined by Heihachi and Toro]]>http://www.joystiq.com/2012/07/06/playstation-all-stars-joined-by-heihachi-and-toro/http://www.joystiq.com/2012/07/06/playstation-all-stars-joined-by-heihachi-and-toro/http://www.joystiq.com/2012/07/06/playstation-all-stars-joined-by-heihachi-and-toro/#comments PlayStation AllStars joined by Heihachi and ToroThe roster in Sony's mascot mashup, PlayStation All-Stars Battle Royale, has grown by two more fighters. Heihachi Mishima from Namco Bandai's Tekken series, and Toro, cartoonish marketing feline for Sony Japan, have both been confirmed for launch (on October 23) by Sony during an EVO 2012 presentation.

In addition to the new characters, a new stage called Dojo has been revealed. Dojo (depicted above) is inspired by Chop Chop Master Onion's stomping/chopping grounds, as seen in Parappa the Rapper.

Update: The PlayStation Blog has posted videos of both characters, which we've embedded below the break.

Continue reading PlayStation All-Stars joined by Heihachi and Toro

JoystiqPlayStation All-Stars joined by Heihachi and Toro originally appeared on Joystiq on Fri, 06 Jul 2012 21:31:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>evo-2012heihachinamco-bandaiplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3superbot-entertainmenttekkentorovitaFri, 06 Jul 2012 21:31:00 EST<![CDATA[PlayStation All-Stars Battle Royale smashing bros on Oct. 23 in NA, Oct. 24 in EU]]>http://www.joystiq.com/2012/07/06/playstation-all-stars-battle-royale-smashing-bros-on-oct-23-in/http://www.joystiq.com/2012/07/06/playstation-all-stars-battle-royale-smashing-bros-on-oct-23-in/http://www.joystiq.com/2012/07/06/playstation-all-stars-battle-royale-smashing-bros-on-oct-23-in/#comments There's still lots that we don't know about SuperBot's PlayStation All-Stars Battle Royale, but today we learned when it'll arrive on store shelves: October 23. At least that's the case for North Americans - Europeans get the game on October 24. And yes, that's the same release date for both PlayStation 3 and Vita versions - Sony's not revealing pricing or more info until its EVO 2012 panel later today (6PM PT). Those scoundrels!

The various costumes seen in the image above are part of the game's pre-order bonus, though someone should probably tell Sony that those giant yellow question marks are gonna look really weird in a fighting game. Honestly, who wants to play as question marks? Come on, guys.

JoystiqPlayStation All-Stars Battle Royale smashing bros on Oct. 23 in NA, Oct. 24 in EU originally appeared on Joystiq on Fri, 06 Jul 2012 12:16:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-vitaps3q4-2012release-datesceasony-computer-entertainment-americasuperbotsuperbot-entertainmentvitaFri, 06 Jul 2012 12:16:00 EST<![CDATA[Sony tags PlayStation All-Stars as 'Super Smash Bros.' on YouTube [Update: Removed!]]]>http://www.joystiq.com/2012/06/04/sony-tags-playstation-all-stars-as-super-smash-bros-on-youtub/http://www.joystiq.com/2012/06/04/sony-tags-playstation-all-stars-as-super-smash-bros-on-youtub/http://www.joystiq.com/2012/06/04/sony-tags-playstation-all-stars-as-super-smash-bros-on-youtub/#comments Sony tags PlayStation All Stars as 'Super Smash Bros'Update: That was quick! Sony has since removed the tags and replaced them with some more appropriate ones - good thing we have the screen cap. You can find our original post below.

Original post: The official YouTube channel for PlayStation has oddly tagged its E3 trailer for PlayStation All-Stars: Battle Royale - specifically, with some "Super Smash Bros." tags. "Super Smash Brothers," "Super Smash Bros" and "SSBB" are all tags visible right now on the YouTube page.

So for how much we're all comparing the new mascot brawler with Nintendo's franchise, it would seem even Sony is willing to acknowledge its influence or is simply looking to grab players looking for Super Smash Bros. content on YouTube.

Hit the jump for a larger version of the page, screen capped for posterity.

Continue reading Sony tags PlayStation All-Stars as 'Super Smash Bros.' on YouTube [Update: Removed!]

JoystiqSony tags PlayStation All-Stars as 'Super Smash Bros.' on YouTube [Update: Removed!] originally appeared on Joystiq on Mon, 04 Jun 2012 23:59:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>e3-2012playstationplaystation-all-stars-battle-royaleplaystation-vitaps3superbot-entertainmentvitaMon, 04 Jun 2012 23:59:00 EST<![CDATA[Smattering of PlayStation All-Stars Battle Royale Vita domains registered by Sony]]>http://www.joystiq.com/2012/05/29/smattering-of-playstation-all-stars-battle-royale-vita-domains-r/http://www.joystiq.com/2012/05/29/smattering-of-playstation-all-stars-battle-royale-vita-domains-r/http://www.joystiq.com/2012/05/29/smattering-of-playstation-all-stars-battle-royale-vita-domains-r/#comments ImageHey, in case you didn't know, that Smash Bros.-esque PlayStation 3 game, PlayStation All-Stars Battle Royale, is very likely also heading to PlayStation Vita. How likely? Pretty freakin' likely, especially considering the recently discovered group of domain registrations from Sony Computer Entertainment of America tied to URLs like "PlaystationAllStarsVita.com," "PS-AllStarsVita.com," and "PSAllStarsBattleRoyaleVita.com."

As with so many of these discoveries, Superannuation spotted the URLs - URLs that pretty clearly identify a Vita-based version of the brawler. We'll be saying this a lot this week, so get used to it: we've reached out to Sony for more info, but only got "we don't comment on rumor or speculation" in return. We expect more info next week during E3.

JoystiqSmattering of PlayStation All-Stars Battle Royale Vita domains registered by Sony originally appeared on Joystiq on Tue, 29 May 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>domaindomain-registrationdomainsplaystationplaystation-all-stars-battle-royaleplaystation-vitaps3sceasony-computer-entertainment-americasony-santa-monicasuperbotsuperbot-entertainmenturlurlsvitaTue, 29 May 2012 15:00:00 EST<![CDATA[Who we'd like to see in PlayStation All-Stars Battle Royale]]>http://www.joystiq.com/2012/04/30/who-wed-like-to-see-in-playstation-all-stars-battle-royale/http://www.joystiq.com/2012/04/30/who-wed-like-to-see-in-playstation-all-stars-battle-royale/http://www.joystiq.com/2012/04/30/who-wed-like-to-see-in-playstation-all-stars-battle-royale/#comments PlayStation All-Stars Battle Royale, a crazy, mashed-up spin on Smash Bros. starring several characters from Sony platforms, was announced last week. We've got six confirmed participants so far: God of War's Kratos, Sly Cooper, Twisted Metal's Sweet Tooth, Killzone 2's Colonel Radec, Parappa the Rapper, and Fat Princess.

We can name a few more that we'd love to see appear in the game, and we've gathered them for your consideration just beyond the break.

Continue reading Who we'd like to see in PlayStation All-Stars Battle Royale

JoystiqWho we'd like to see in PlayStation All-Stars Battle Royale originally appeared on Joystiq on Mon, 30 Apr 2012 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-allstars-battle-royaleps3sceasony-computer-entertainment-americasony-santa-monicasuperbotsuperbot-entertainmentMon, 30 Apr 2012 17:00:00 EST<![CDATA[PlayStation All-Stars: Battle Royale smashes through the PlayStation library]]>http://www.joystiq.com/2012/04/27/playstation-all-stars-battle-royale-smashes-through-the-playsta/http://www.joystiq.com/2012/04/27/playstation-all-stars-battle-royale-smashes-through-the-playsta/http://www.joystiq.com/2012/04/27/playstation-all-stars-battle-royale-smashes-through-the-playsta/#comments ImageAfter months of rumors, Sony has officially revealed PlayStation All-Stars: Battle Royale, a brawler featuring multiple franchises from the PlayStation library. As suggested back in November, the PlayStation 3 title is in development at SuperBot Entertainment. The now-official game was available for hands-on sessions at a recent PlayStation event in Los Angeles.

The basic conceit of the game is that Sony decided to clone the concepts behind Nintendo's Smash Bros. series or Capcom's Power Stone. PlayStation All-Stars fits that characterization almost exactly: characters from various video game worlds battle in arenas, environments are pulled from recognizable franchises, and everything boils into an evolving bucket of crazy.

But that doesn't discount that PlayStation All-Stars was a fun game to play, with some unique ideas that turn it into the video game equivalent of the instant-classic PlayStation television ad "Michael." Sure, it's Smash Bros. with PlayStation characters, but given the choice between Waluigi and Kratos, I'll gladly go with the God of War.

Gallery: PlayStation All-Stars: Battle Royale (4/27/12)

Continue reading PlayStation All-Stars: Battle Royale smashes through the PlayStation library

JoystiqPlayStation All-Stars: Battle Royale smashes through the PlayStation library originally appeared on Joystiq on Fri, 27 Apr 2012 03:05:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationplaystation-all-stars-battle-royaleplaystation-allstars-battle-royaleps3superbot-entertainmentFri, 27 Apr 2012 03:05:00 EST<![CDATA[PlayStation All-Stars: Battle Royale coming to PS3 this year]]>http://www.joystiq.com/2012/04/27/playstation-all-stars-battle-royale-coming-to-ps3-this-year/http://www.joystiq.com/2012/04/27/playstation-all-stars-battle-royale-coming-to-ps3-this-year/http://www.joystiq.com/2012/04/27/playstation-all-stars-battle-royale-coming-to-ps3-this-year/#comments ImageIt's a good thing that Sony registered a URL for PlayStation All-Stars: Battle Royale, because developer SuperBot Entertainment has been working on a game named just that!

Though rumors about the title have been swirling since November 2011, Sony is ready to reveal the brawler to the world. Taking cues from Nintendo's mash-up series, Smash Bros., SuperBot's first title sees recognizable PlayStation characters square off in four-player multiplayer arena-based battles. PlayStation All-Stars: Battle Royale is set to hit the PS3 later this year.

Joystiq went hands-on with the game earlier this week and will have a preview available for your late-night reading pleasure momentarily.

JoystiqPlayStation All-Stars: Battle Royale coming to PS3 this year originally appeared on Joystiq on Fri, 27 Apr 2012 03:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationPlayStation-All-Starsplaystation-all-stars-battle-royaleplaystation-allstars-battle-royaleps3SuperBot-EntertainmentFri, 27 Apr 2012 03:00:00 EST<![CDATA[Sony registers domain for 'PlayStation All-Stars Battle Royale']]>http://www.joystiq.com/2012/04/21/sony-registers-domain-for-playstation-all-stars-battle-royale/http://www.joystiq.com/2012/04/21/sony-registers-domain-for-playstation-all-stars-battle-royale/http://www.joystiq.com/2012/04/21/sony-registers-domain-for-playstation-all-stars-battle-royale/#comments ImageBack in November of last year, rumors swirled over Title Fight, which was reportedly an unannounced brawler/fighting game staring characters from various Sony and PlayStation-exclusive franchises, like Heavenly Sword and God of War.

The game was said to be in development at SuperBot Entertainment, and that's about all that ever came of it, since the rumor died off almost as quickly as it had flared into life. Now though, new life has been injected into its whimpering husk with the registration of an extremely longwinded URL: http://www.playstationallstarsbattleroyale.com

If we follow the rumor train's logic tracks, PlayStation All-Stars Battle Royale is Title Fight's actual name, and the game is set to be officially announced on Spike TV this Thursday. The URL does belong to "Sony Computer Entertainment America LLC," according to the its whois information, so that much at least has been verified as totes legit. As for whether this thing is what became of Title Fight, however, we'll have to wait and see. One thing's for sure, though: That URL is way too long.

JoystiqSony registers domain for 'PlayStation All-Stars Battle Royale' originally appeared on Joystiq on Sat, 21 Apr 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>playstationPlayStation-All-Stars-Battle-Royaleps3SCEAsonySony-Computer-Entertainment-Americasuperbot-entertainmentTitle-FightSat, 21 Apr 2012 21:00:00 EST<![CDATA[Rumor: Sony working on a Smash Bros-esque fighter featuring Sony all-stars]]>http://www.joystiq.com/2011/11/28/rumor-sonys-got-a-smash-bros-esque-fighter-in-the-works-featur/http://www.joystiq.com/2011/11/28/rumor-sonys-got-a-smash-bros-esque-fighter-in-the-works-featur/http://www.joystiq.com/2011/11/28/rumor-sonys-got-a-smash-bros-esque-fighter-in-the-works-featur/#comments The hat of "Sony Mascot" has been worn by many, many different critters and folk since the days of Crash Bandicoot and, uh, Croc. In fact, Sony's stable of lovable household names is so fully stocked that they've decided to pit their creations against one another to determine who lives and who dies.

Okay so, that last part might be a little hyperbolic, but the rumor mill is operating at full capacity over Title Fight, a Super Smash Bros.-ish cross-franchise brawler reportedly in development at SuperBot Entertainment, according to The Paul Gale Network. If rumors are to be believed, the game will feature a cast of Sony-console specific characters like Nathan Drake, Sweet Tooth, Sly Cooper, that guy from Killzone and Fat Princess. Fights will take place in various Sony related locations such as Sandover Village or a golf course from Hot Shots Golf.

The gallery of images below, which shows Sweet Tooth, a blank female form that may or may not be Heavenly Sword's Nariko and a debug screen that mentions Kratos, were tweeted (and subsequently deleted) by SuperBot Entertainment's senior level designer Chris Molina. Apparently, this hullabaloo is also what that franchise-rich teaser trailer from September was all about, which would also indicate the inclusion of Parappa the Rapper, as well as a representative from FOXHOUND.

If all this pans out, Title Fight will be the latest in a long, proud history of SCEA-published fighting games like Battle Arena Toshinden and Cardinal Syn. We'll keep our ear to the ground for more as this story develops.

Gallery: Title Fight (Tentative, Leaked)

JoystiqRumor: Sony working on a Smash Bros-esque fighter featuring Sony all-stars originally appeared on Joystiq on Mon, 28 Nov 2011 18:40:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>crash-bandicootcrocfat-princessheavenly-swordjak-and-daxterkillzonenarikoparappa-the-rapperplaystationps3ps3-exclusiverumorsly-coopersuperbot-entertainmentsweet-toothtitle-fightMon, 28 Nov 2011 18:40:00 EST