Joystiq http://www.joystiq.com Joystiq http://www.blogsmithmedia.com/http://www.joystiq.com/media/feedlogo.gif Joystiq http://www.joystiq.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Quantum Conundrum coming to PC June 21]]>http://www.joystiq.com/2012/05/31/quantum-conundrum-coming-to-pc-june-21/http://www.joystiq.com/2012/05/31/quantum-conundrum-coming-to-pc-june-21/http://www.joystiq.com/2012/05/31/quantum-conundrum-coming-to-pc-june-21/#comments ImageSquare Enix has finally laid down a launch date for Quantum Conundrum: The game will arrive on Windows via Steam on June 21. You can preorder the game right now either as a standard edition, or as a "season pass," with three exclusive Team Fortress 2 items, a downloadable soundtrack, and all of the future puzzle packs.

Preordering the game also earns you 10 percent off, and you'll be entered into a sweepstakes to win the opportunity to have your portrait hung up in the in-game world. Snazzy! Quantum Conundrum will also arrive on Microsoft's XBLA and PSN, though Square is only sticking with "summer" as a date for those versions so far.

JoystiqQuantum Conundrum coming to PC June 21 originally appeared on Joystiq on Thu, 31 May 2012 20:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>airtight-gamesdlcgamekim-swiftpcpreorderquantum-conundrumseason-passsquare-enixsteamThu, 31 May 2012 20:00:00 EST<![CDATA[Quantum Conundrum trailer gives us a cute creature to coo over]]>http://www.joystiq.com/2012/05/31/quantum-conundrum-trailer-gives-us-a-cute-creature-to-coo-over/http://www.joystiq.com/2012/05/31/quantum-conundrum-trailer-gives-us-a-cute-creature-to-coo-over/http://www.joystiq.com/2012/05/31/quantum-conundrum-trailer-gives-us-a-cute-creature-to-coo-over/#comments Image

Not since the Ewok have we been so immediately in love with a short chubby hairy thing. Sorry, John De Lancie - this little guy is now our favorite Quantum Conundrum character.

JoystiqQuantum Conundrum trailer gives us a cute creature to coo over originally appeared on Joystiq on Thu, 31 May 2012 03:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>airtight-gameskim-swiftmicrosoftpcplaystationps3quantum-conundrumsquare-enixxboxThu, 31 May 2012 03:00:00 EST<![CDATA[Just Cause dev working on another open-world action game]]>http://www.joystiq.com/2012/05/31/just-cause-dev-working-on-another-open-world-action-game/http://www.joystiq.com/2012/05/31/just-cause-dev-working-on-another-open-world-action-game/http://www.joystiq.com/2012/05/31/just-cause-dev-working-on-another-open-world-action-game/#comments ImageJust Cause developer Avalanche Studios is working on yet another open-world action game, Eurogamer reports. Avalanche Studios is hiring for multiple projects on both current consoles and the next generation - even two games based on film and comic properties - due in 2013 and 2014. One game we knew about: Project Mamba.

Of course, the first thing that comes to mind is Just Cause 3 - Square Enix has picked up some curious domains on top of publishing the first two Just Cause games, and Avalanche has publicly said it would love to continue working on the franchise. With multiple projects in the works, one of them could be a sequel to 2010's outing.

JoystiqJust Cause dev working on another open-world action game originally appeared on Joystiq on Thu, 31 May 2012 01:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>actionavalanche-studiosopen-worldsandboxsquare-enixThu, 31 May 2012 01:00:00 EST<![CDATA[Heroes of Ruin delayed until July in North America]]>http://www.joystiq.com/2012/05/30/heroes-of-ruin-delayed-until-july-in-north-america/http://www.joystiq.com/2012/05/30/heroes-of-ruin-delayed-until-july-in-north-america/http://www.joystiq.com/2012/05/30/heroes-of-ruin-delayed-until-july-in-north-america/#comments Co-op 3DS dungeon crawler Heroes of Ruin got a little lost on the way to North America and will be delayed by a month. Developer n-Space noted on its Facebook page today that the game will launch on July 17 in North America, instead of the previously announced June 26 date.

The release date in Europe for the Square Enix published game remains steady at June 15.

[Thanks, Brendan M.]

Gallery: Heroes of Ruin (Coral Tombs)

JoystiqHeroes of Ruin delayed until July in North America originally appeared on Joystiq on Wed, 30 May 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3dsDelayheroes-of-ruinnintendoSquare-EnixWed, 30 May 2012 14:30:00 EST<![CDATA[iOS and Android enter 'Final Fantasy Dimensions' this summer]]>http://www.joystiq.com/2012/05/30/ios-and-android-enter-final-fantasy-dimensions-this-summer/http://www.joystiq.com/2012/05/30/ios-and-android-enter-final-fantasy-dimensions-this-summer/http://www.joystiq.com/2012/05/30/ios-and-android-enter-final-fantasy-dimensions-this-summer/#comments ImageSquare Enix's E3 lineup is packed with unannounced iOS and Android games (packed), but the one that seems most noteworthy is Final Fantasy Dimensions, due this summer on both iOS and Android. "Drawing upon the roots of the series with such features as beautiful 2D pixel art, job-driven character growth, additional scenarios in which to inherit the jobs of your adventuring companions, and a classic story of light, darkness, and crystals," the description reads, "FINAL FANTASY DIMENSIONS delivers the best of FINAL FANTASY, retro and fresh alike, directly to your smartphone."

It sounds like a new game in the classic Final Fantasy style. Judging by the logo, we're guessing it's a smartphone conversion and localization of the Japanese cell phone game, Final Fantasy Legends, which was released episodically in 2010.

The other newly announced game that piqued our interest the most was "Demons' Score", an Unreal Engine 3-powered "breakbeat action game that seamlessly fuses music and battles."

Continue reading iOS and Android enter 'Final Fantasy Dimensions' this summer

JoystiqiOS and Android enter 'Final Fantasy Dimensions' this summer originally appeared on Joystiq on Wed, 30 May 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>androiddemons-scorefinal-fantasyfinal-fantasy-dimensionsiosiphonemobilesquare-enixWed, 30 May 2012 10:30:00 EST<![CDATA[Hitman: Absolution has nuns to make Agent 47 run (spoiler: he doesn't)]]>http://www.joystiq.com/2012/05/30/hitman-absolution-has-nuns-to-make-agent-47-run-spoiler-he-do/http://www.joystiq.com/2012/05/30/hitman-absolution-has-nuns-to-make-agent-47-run-spoiler-he-do/http://www.joystiq.com/2012/05/30/hitman-absolution-has-nuns-to-make-agent-47-run-spoiler-he-do/#comments
Turns out yesterday's Hitman Absolution tease, which featured a bunch of Kasumi Goto silhouettes, was actually showing off the naughty nuns from the clip above. Using only a minuscule amount of his silent assassin repertoire, Agent 47 takes out an ICA (his former employer) hit squad, known as "The Saints," in brutal fashion.

Those looking for something a little less up-close-and-personal can pre-order Hitman: Absolution now from GameStop and obtain the Hitman: Sniper Challenge as a bonus. Agent 47 runs (and kills) for his life once again on November 20.

JoystiqHitman: Absolution has nuns to make Agent 47 run (spoiler: he doesn't) originally appeared on Joystiq on Wed, 30 May 2012 08:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>hitman-5hitman-absolutionIO-Interactivemicrosoftpcplaystationps3Square-EnixxboxWed, 30 May 2012 08:30:00 EST<![CDATA[Meet Hong Kong's Yaku ... er, Triads in the latest Sleeping Dogs trailer]]>http://www.joystiq.com/2012/05/25/meet-hong-kongs-yaku-er-triads-in-the-latest-sleeping-dogs/http://www.joystiq.com/2012/05/25/meet-hong-kongs-yaku-er-triads-in-the-latest-sleeping-dogs/http://www.joystiq.com/2012/05/25/meet-hong-kongs-yaku-er-triads-in-the-latest-sleeping-dogs/#comments
United Front Games' Sleeping Dogs seems awfully reminiscent of another open-world, minigame-filled action game with a connection to another well-known Asian mafia, but we just can't seem to put our finger on it. Perhaps you can help identify the mystery inspiration?

Continue reading Meet Hong Kong's Yaku ... er, Triads in the latest Sleeping Dogs trailer

JoystiqMeet Hong Kong's Yaku ... er, Triads in the latest Sleeping Dogs trailer originally appeared on Joystiq on Fri, 25 May 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>gameplaymicrosoftplaystationps3sleeping-dogssquare-enixunited-front-gamesxboxFri, 25 May 2012 16:00:00 EST<![CDATA[Square Enix registers domains for 'Just Cause 4' despite lack of Just Cause 3]]>http://www.joystiq.com/2012/05/21/square-enix-registers-domains-for-just-cause-4-despite-lack-of/http://www.joystiq.com/2012/05/21/square-enix-registers-domains-for-just-cause-4-despite-lack-of/http://www.joystiq.com/2012/05/21/square-enix-registers-domains-for-just-cause-4-despite-lack-of/#comments Just in case the Just Cause series is successful enough to get a fourth entry, Square Enix wants to make sure it can employ any necessary URLs. As such, the company registered URLs in a variety of countries for "JustCause4" via URL proxy registrant Corporation Service Company, as discovered by Fusible.

Neither Square Enix nor Avalance Studios have said much about the Just Cause series as of late, though Avalance studio head Christofer Sundberg told Develop in early 2010 that a third entry in the series is very likely. It's also rumored that Avalanche has been working on a Mad Max-based game; we haven't heard about that project since September 2010. Beyond Avalanche's Stockholm-based studio, the privately owned Swedish company opened a New York City office in 2011 to work on an unannounced game only known as "Project Mamba."

Regardless, with just a few weeks left until E3, it's likely we'll hear more about whatever Avalanche is working on sooner, rather than later.

JoystiqSquare Enix registers domains for 'Just Cause 4' despite lack of Just Cause 3 originally appeared on Joystiq on Mon, 21 May 2012 10:50:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>avalancheavalanche-studioschristofer-sundbergcorporation-service-companydomain-registrationjust-causejust-cause-3just-cause-4square-enixurlMon, 21 May 2012 10:50:00 EST<![CDATA[Quantum Conundrum's latest trailer blows the doors off time, our minds]]>http://www.joystiq.com/2012/05/17/quantum-conundrums-latest-trailer-blows-the-doors-off-time-our/http://www.joystiq.com/2012/05/17/quantum-conundrums-latest-trailer-blows-the-doors-off-time-our/http://www.joystiq.com/2012/05/17/quantum-conundrums-latest-trailer-blows-the-doors-off-time-our/#comments Image
Quantum Conundrum's more than just fluffy pillows and super heavy stuff. It's also all about ripping apart space and time itself at your whim, with the helpful aid of a glove-enabled "shift device," as demonstrated in the trailer above.

JoystiqQuantum Conundrum's latest trailer blows the doors off time, our minds originally appeared on Joystiq on Thu, 17 May 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>airtightairtight-gamesgameplaykim-swiftmicrosoftpcplaystationps3quantum-conundrumsquare-enixtrailerxboxThu, 17 May 2012 18:00:00 EST<![CDATA[This Sleeping Dogs trailer is pretty violent, you guys]]>http://www.joystiq.com/2012/05/14/this-sleeping-dogs-trailer-is-pretty-violent-you-guys/http://www.joystiq.com/2012/05/14/this-sleeping-dogs-trailer-is-pretty-violent-you-guys/http://www.joystiq.com/2012/05/14/this-sleeping-dogs-trailer-is-pretty-violent-you-guys/#comments
We're all for a good bit of Hong Kong-style fisticuffs, but why would you ever slam a guy's face into an active table saw? That's totally uncalled for, Sleeping Dogs guy!

JoystiqThis Sleeping Dogs trailer is pretty violent, you guys originally appeared on Joystiq on Mon, 14 May 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>microsoftpcplaystationps3sleeping-dogssquare-enixunited-front-gamesxboxMon, 14 May 2012 18:30:00 EST<![CDATA[Square Enix sees 6 billion yen profit in fiscal 2012 thanks to Deus Ex, FFXIII-2]]>http://www.joystiq.com/2012/05/14/square-enix-sees-6-billion-yen-profit-in-fiscal-2012-thanks-to-d/http://www.joystiq.com/2012/05/14/square-enix-sees-6-billion-yen-profit-in-fiscal-2012-thanks-to-d/http://www.joystiq.com/2012/05/14/square-enix-sees-6-billion-yen-profit-in-fiscal-2012-thanks-to-d/#comments Square Enix's financial results for fiscal 2012 have been posted, and thanks to the releases of Deus Ex: Human Revolution and Final Fantasy XIII-2, the developer has ended the year in the black, to the tune of a ¥6.06 billion (or $75.9 million) profit.

Total income from sales for the fiscal year, which for Square Enix ran from April 2011 through March 2012, totaled up to ¥127.89 billion ($1.6 billion) - a 2.1 percent year-over-year increase. After subtracting taxes and operating costs, the company was left with over ¥6 billion in profit, which must be welcome news for stockholders still feeling the sting from Square Enix's ¥12.04 billion ($150.86 million) loss in fiscal 2011.

"In the fiscal year ended March 31, 2012, we continued our efforts aimed at increasing profitability, including establishing best practices for the content in said growth areas, improving quality of our major online game, and strengthening our global structure," said Square Enix president Yoichi Wada in a statement accompanying the financial report. "We are accelerating the reformation to generate a substantial earnings improvement in the fiscal year ending March 31, 2013 and beyond."

JoystiqSquare Enix sees 6 billion yen profit in fiscal 2012 thanks to Deus Ex, FFXIII-2 originally appeared on Joystiq on Mon, 14 May 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>financialsfiscal-2012iosipadiphonemicrosoftmobilepcplaystationps3Square-EnixxboxMon, 14 May 2012 16:00:00 EST<![CDATA[Tomb Raider delayed until Q1 2013]]>http://www.joystiq.com/2012/05/14/tomb-raider-delayed-until-q1-2013/http://www.joystiq.com/2012/05/14/tomb-raider-delayed-until-q1-2013/http://www.joystiq.com/2012/05/14/tomb-raider-delayed-until-q1-2013/#comments The younger, dirtier and unvarnished version of Lara Croft still needs some polish, according to Crystal Dynamics. The developer is pushing back the release date of the next Tomb Raider, from Fall 2012 into the first quarter of 2013. (Yes, the same quarter that now hosts another one of 2012's former heavy hitters, Bioshock Infinite.)

"Our priority now is to make sure we fully deliver the very highest quality game," Crystal Dynamics Head Darrell Gallagher wrote. In a missive posted on the game's official forums, Gallagher shared the studio's push to make Tomb Raider "the best game of our careers." The delay will boost quality up to "a level that you deserve," he said.

The shift in release date has also given us an unexpected sense of optimism. If enough promising games get pushed into next year, we might actually start rooting for the world's continued existence beyond 2012.

JoystiqTomb Raider delayed until Q1 2013 originally appeared on Joystiq on Mon, 14 May 2012 02:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2013crystal-dynamicsdarrell-gallagherdelaylara-croftmicrosoftplaystationps3q1-2013release-datesquare-enixtomb-raider-2011tomb-raider-2012tomb-raider-2013xboxMon, 14 May 2012 02:30:00 EST<![CDATA['Hitman: Sniper Challenge' official, only available as GameStop pre-order]]>http://www.joystiq.com/2012/05/10/hitman-sniper-challenge-official-only-available-as-gamestop/http://www.joystiq.com/2012/05/10/hitman-sniper-challenge-official-only-available-as-gamestop/http://www.joystiq.com/2012/05/10/hitman-sniper-challenge-official-only-available-as-gamestop/#comments
Confirming the leak from Tuesday, Square Enix has announced the Hitman: Sniper Challenge as a pre-order bonus for Hitman: Absolution. The challenge will be available beginning May 15 at GameStop for those who pre-order Absolution, which will take its shot at retail on November 20. A Steam version of the Sniper Challenge will be available August 1, with details on how to gain access coming later.

The Sniper Challenge is a standalone experience, with Agent 47 tasked with taking out a mark and all his bodyguards from a rooftop. Efficiency is key and will grant score multipliers and unlock equipment upgrades (some which will transfer to Absolution). Progress of the best snipers will be tracked on a leaderboard and the best of the best snipers in North America will win a trip for two to Copenhagen, Denmark, where they will meet the Hitman development team.

...or they'll be drafted by the CIA into some La Femme Nikita situation.

Gallery: Hitman Absolution (Hitman: Sniper Challenge)

Continue reading 'Hitman: Sniper Challenge' official, only available as GameStop pre-order

Joystiq'Hitman: Sniper Challenge' official, only available as GameStop pre-order originally appeared on Joystiq on Thu, 10 May 2012 09:50:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>gamestophitman-5hitman-absolutionHitman-Sniper-ChallengeIO-Interactivemicrosoftpcplaystationps3Square-EnixxboxThu, 10 May 2012 09:50:00 EST<![CDATA[Hitman: Absolution sneaking up to retail on November 20]]>http://www.joystiq.com/2012/05/10/hitman-absolution-sneaking-up-to-retail-on-november-20/http://www.joystiq.com/2012/05/10/hitman-absolution-sneaking-up-to-retail-on-november-20/http://www.joystiq.com/2012/05/10/hitman-absolution-sneaking-up-to-retail-on-november-20/#comments ImageAgent 47 isn't doing a very good job with that whole sneaking around thing, as we found out pretty easily this morning that his next game, Hitman: Absolution, launches November 20.

Publisher Square Enix announced the date this morning alongside news that pre-orders will get access to a ... whole other Hitman title. Not too shabby!

JoystiqHitman: Absolution sneaking up to retail on November 20 originally appeared on Joystiq on Thu, 10 May 2012 09:35:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>hitman-5hitman-absolutionio-interactivemicrosoftpcplaystationps3q4-2012release-datesquare-enixxboxThu, 10 May 2012 09:35:00 EST<![CDATA[Hitman: Absolution's Agent 47 reminds us of his O.G. status]]>http://www.joystiq.com/2012/05/02/hitman-absolutions-agent-47-reminds-us-of-his-o-g-status/http://www.joystiq.com/2012/05/02/hitman-absolutions-agent-47-reminds-us-of-his-o-g-status/http://www.joystiq.com/2012/05/02/hitman-absolutions-agent-47-reminds-us-of-his-o-g-status/#comments
The Hitman folks probably should've stuck the word "assassin" somewhere in their game title - that way they could avoid embarrassing marketing moments. Take, for instance, the trailer above's insistence that Agent 47 is the "original" assassin. Doesn't his blood-soaked legacy speak for itself?

Continue reading Hitman: Absolution's Agent 47 reminds us of his O.G. status

JoystiqHitman: Absolution's Agent 47 reminds us of his O.G. status originally appeared on Joystiq on Wed, 02 May 2012 09:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>agent-47eidoseidos-interactivegameplayhitman-5hitman-absolutionio-interactivemicrosoftpcplaystationps3square-enixxboxWed, 02 May 2012 09:30:00 EST<![CDATA[Lara Croft and the Guardian of Light ported to the BlackBerry PlayBook]]>http://www.joystiq.com/2012/05/01/lara-croft-and-the-guardian-of-light-ported-to-the-blackberry-pl/http://www.joystiq.com/2012/05/01/lara-croft-and-the-guardian-of-light-ported-to-the-blackberry-pl/http://www.joystiq.com/2012/05/01/lara-croft-and-the-guardian-of-light-ported-to-the-blackberry-pl/#comments ImageLara Croft and the Guardian of Light has been generally recognized as a great downloadable game that should be played by as many people as possible, which is why we're confused about its launch on the BlackBerry PlayBook. Get it? Because no one owns a PlayBook.

That's not true, we realize, but all is fair in love and bad comedy. Already a few happy PlayBookers and/or RIM and Square Enix employees have left gushing reviews on Guardian of Light's App World page, suggesting it's a solid experience even two years out and even on PlayBook. Lara Croft and the Guardian of Light is available now for $3.99 via the BlackBerry App World.

JoystiqLara Croft and the Guardian of Light ported to the BlackBerry PlayBook originally appeared on Joystiq on Tue, 01 May 2012 07:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>BlackBerrylara-croft-and-the-guardian-of-lightmobileplaybookSquare-EnixtabletTue, 01 May 2012 07:30:00 EST<![CDATA[Deus Ex: Human Revolution, Dungeon Siege 3 PC deeply discounted on Amazon this week]]>http://www.joystiq.com/2012/04/30/deus-ex-human-revolution-dungeon-siege-3-pc-deeply-discounted/http://www.joystiq.com/2012/04/30/deus-ex-human-revolution-dungeon-siege-3-pc-deeply-discounted/http://www.joystiq.com/2012/04/30/deus-ex-human-revolution-dungeon-siege-3-pc-deeply-discounted/#comments ImageDeus Ex: Human Revolution, one of the best games of 2011, is on super sale this week through Amazon's digital distribution service for PC. The Standard Edition of the cyber stealth thriller is $6.99, while the Augmented Edition, which includes art book and soundtrack, is a dollar more for $7.99.

Also on discount is Dungeon Siege 3, which has reviews that start in the 80s and go south from there (we thought it was good), but for $5 it's not a heavy investment to try out for yourself.

PC players who are interested in further discounts should check out Amazon's new "Weekly Deal Vote." PC titles were recently added and the hive mind decides what game will drop to $5 next week.

JoystiqDeus Ex: Human Revolution, Dungeon Siege 3 PC deeply discounted on Amazon this week originally appeared on Joystiq on Mon, 30 Apr 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>deus-ex-human-revolutiondungeon-siege-3pcSquare-EnixMon, 30 Apr 2012 14:30:00 EST<![CDATA[Soul Reaver shifts planes to GOG.com]]>http://www.joystiq.com/2012/04/26/soul-reaver-shifts-planes-to-gog-com/http://www.joystiq.com/2012/04/26/soul-reaver-shifts-planes-to-gog-com/http://www.joystiq.com/2012/04/26/soul-reaver-shifts-planes-to-gog-com/#comments
Raziel has been to many strange and wonderful places, but he's never been to Good Old Games until now. Legacy of Kain: Soul Reaver is now available on the service for $6. Soul Reaver tells the tale of a betrayed vampire-turned-revenant, Raziel, and his vengeance against those who wronged him.

It also sports a top-notch voice cast and, hey, it's fun to play. If you missed it the first time around (or if you feel like reliving it again), it's definitely worth checking out.

JoystiqSoul Reaver shifts planes to GOG.com originally appeared on Joystiq on Thu, 26 Apr 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>Crystal-Dynamicsgoggog.comlegacy-of-kain-soul-reaverpcsquare-enixThu, 26 Apr 2012 18:00:00 EST<![CDATA[Hitman: Absolution trailers draw a bead on its characters]]>http://www.joystiq.com/2012/04/26/hitman-absolution-trailers-draw-a-bead-on-its-characters/http://www.joystiq.com/2012/04/26/hitman-absolution-trailers-draw-a-bead-on-its-characters/http://www.joystiq.com/2012/04/26/hitman-absolution-trailers-draw-a-bead-on-its-characters/#comments Image
The bald and bar-coded Agent 47 isn't the only character in Hitman: Absolution, you know. The latest trailers introduce us to Benjamin Travis and Jade - members of 47's employer, "The Agency" - and the actors who play them.

Continue reading Hitman: Absolution trailers draw a bead on its characters

JoystiqHitman: Absolution trailers draw a bead on its characters originally appeared on Joystiq on Thu, 26 Apr 2012 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>hitman-5hitman-absolutionIO-Interactivemicrosoftpcplaystationps3square-enixxboxThu, 26 Apr 2012 13:00:00 EST<![CDATA[Square Enix hints, nudges and winks about The World Ends With You sequel]]>http://www.joystiq.com/2012/04/21/square-enix-hints-nudges-and-winks-about-the-world-ends-with-yo/http://www.joystiq.com/2012/04/21/square-enix-hints-nudges-and-winks-about-the-world-ends-with-yo/http://www.joystiq.com/2012/04/21/square-enix-hints-nudges-and-winks-about-the-world-ends-with-yo/#comments The World Ends With You is, besides being an excellent name for a My Chemical Romance song, one of the few non-Final Fantasy RPGs from Square Enix to obtain cult classic status. The last we heard of a potential sequel to the teenager-infused romp through Shibuya was in August of 2010, when series artist Tetsuya Nomura said "I definitely want to make a sequel."

Fast-forward about a year, and The World Ends With You protagonist Neku is spotted as one of the many cameos during Kingdom Hearts 3D: Dream Drop Distance's Tokyo Game Show demo. Now, Nomura has said that TWEWY supporting character Raimu, who never spoke during the original game, will also be in Kingdom Hearts 3D and will be fully voice acted "out of consideration of the future of The World Ends With You series," according to an interview translated by Andriasang.

If that weren't powerfully tantalizing on its own, Nomura also said that "there probably is something" coming in the series' future, though he couldn't speak in specifics at the time. He also laughed mid-sentence, according to the translation, although there's no context provided to indicate whether the laugh was the playful chuckle of an appreciative artist, or the maniacal cackling of a man manipulating the hearts of thousands. Without this vital context clue, we'll just have to wait and see what happens.

JoystiqSquare Enix hints, nudges and winks about The World Ends With You sequel originally appeared on Joystiq on Sat, 21 Apr 2012 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dskingdom-hearts-3dkingdom-hearts-3d-dream-drop-distancenintendosequelsquare-enixTetsuya-NomuraThe-World-Ends-With-YouSat, 21 Apr 2012 16:30:00 EST<![CDATA[Sleeping Dogs awaken on August 14; pre-order bonuses defined]]>http://www.joystiq.com/2012/04/13/sleeping-dogs-awaken-on-august-14-pre-orders-defined/http://www.joystiq.com/2012/04/13/sleeping-dogs-awaken-on-august-14-pre-orders-defined/http://www.joystiq.com/2012/04/13/sleeping-dogs-awaken-on-august-14-pre-orders-defined/#comments ImageHong Kong-based action game Sleeping Dogs will launch at retail on August 14. Publisher Square Enix announced the game's launch date this morning alongside news of three separate pre-order bonuses tied to three separate retailers: Best Buy, GameStop, and Amazon.

Should you choose to go the brick-and-mortar route, Best Buy is offering the "Georges St. Pierre Pack," which features a trio of GSP-related gear and moves (his "signature flying punch," for instance). GameStop is similarly offering a slew of in-game content, dubbed the "Police Protection Pack. As you might imagine, it comes with a variety of police officer-themed gear. Finally, Amazon has the "Martial Arts Pack," which ... well ... you get it at this point, right? For full listings of all the gear, head past the break.

Oh, and if you're a PC gamer wondering what your fancy pre-order bonus is, know that Square Enix hasn't forgotten about you: "Exclusive content for the digitally downloadable PC version of Sleeping Dogs will be announced at a later date," the press release reads.

Continue reading Sleeping Dogs awaken on August 14; pre-order bonuses defined

JoystiqSleeping Dogs awaken on August 14; pre-order bonuses defined originally appeared on Joystiq on Fri, 13 Apr 2012 10:12:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>microsoftpcplaystationps3q3-2012release-datesleeping-dogssquare-enixunited-front-gamesxboxFri, 13 Apr 2012 10:12:00 EST<![CDATA[MMA fighter Georges St-Pierre consulting on Sleeping Dogs]]>http://www.joystiq.com/2012/04/11/mma-fighter-georges-st-pierre-consulting-on-sleeping-dogs/http://www.joystiq.com/2012/04/11/mma-fighter-georges-st-pierre-consulting-on-sleeping-dogs/http://www.joystiq.com/2012/04/11/mma-fighter-georges-st-pierre-consulting-on-sleeping-dogs/#comments Square Enix has enlisted the help of UFC Welterweight Champion Georges St-Pierre (aka GSP), who will now be contributing his expertise on punching/grappling dudes to Sleeping Dogs. While GSP is said to be working on "multiple elements" of the Hong Kongian crime thriller, we have an inkling that he'll be lending the majority of his vast, worldly knowledge to the game's combat systems.

Actually, now that we've remembered how huge his bulging muscles are and how easily he could grind our puny frames into a fine mist, we suppose its entirely possible that GSP could be consulting on the game's art direction, or acting as a continuity editor for the script. In fact, forget we ever implied anything to the contrary.

Continue reading MMA fighter Georges St-Pierre consulting on Sleeping Dogs

JoystiqMMA fighter Georges St-Pierre consulting on Sleeping Dogs originally appeared on Joystiq on Wed, 11 Apr 2012 14:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>GEORGES-ST-PIERREGSPmicrosoftpcplaystationps3sleeping-dogssquare-enixsquare-enix-europesquare-enix-london-studiosxboxWed, 11 Apr 2012 14:30:00 EST<![CDATA[Hitman: Absolution gets a well-dressed 'Professional Edition' [update: EU and NA]]]>http://www.joystiq.com/2012/04/11/hitman-absolution-gets-a-well-dressed-professional-edition-in/http://www.joystiq.com/2012/04/11/hitman-absolution-gets-a-well-dressed-professional-edition-in/http://www.joystiq.com/2012/04/11/hitman-absolution-gets-a-well-dressed-professional-edition-in/#comments ImageDon't get too excited - we thought the image above revealed some kind of replica gun in a cool briefcase as part of the Hitman: Absolution "Professional Edition," but it's actually bonus in-game DLC. Oh well, no toy guns for us! Said DLC, the "Agency Gun Pack," comprises a Jagd P22G pistol, a UMP SMG and an SPS 12 semi-automatic shotgun.

The Professional Edition, announced for Europe today, also includes an art book, a making-of DVD, and a fancy clamshell box. We're due to get some kind of special edition in North America as well, but details haven't been announced yet.

Update: the North American release will have the same "Professional Edition." In addition, Square Enix announced retail-exclusive bonuses for Amazon (the "Bartoli Custom Pistol"), Best Buy (the "Bronson 1928M SMG"), GameStop (the "Agency Kazo TRG" sniper rifle), and Walmart (the "Krugermeier 2-2 Pistol").

Gallery: Hitman: Absolution (Pre-Order Items)

JoystiqHitman: Absolution gets a well-dressed 'Professional Edition' [update: EU and NA] originally appeared on Joystiq on Wed, 11 Apr 2012 10:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>europehitman-5hitman-absolutionIO-Interactivemicrosoftpcplaystationprofessional-editionps3special-editionsquare-enixxboxWed, 11 Apr 2012 10:30:00 EST<![CDATA[Kingdom Hearts 3D drops into North America on July 31]]>http://www.joystiq.com/2012/04/05/kingdom-hearts-3d-dream-drop-distance-july-31/http://www.joystiq.com/2012/04/05/kingdom-hearts-3d-dream-drop-distance-july-31/http://www.joystiq.com/2012/04/05/kingdom-hearts-3d-dream-drop-distance-july-31/#comments ImageKingdom Hearts 3D [Dream Drop Distance] -- also known by its maiden name: Kingdom Hearts 3D 24/365 Deplorable Overdrive Cross-Fiction Heart Battle -- will be available on 3DS in North America on July 31.

Gallery: Kingdom Hearts 3D: Dream Drop Distance (3/29/12)

JoystiqKingdom Hearts 3D drops into North America on July 31 originally appeared on Joystiq on Thu, 05 Apr 2012 12:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>kingdom-hearts-3dkingdom-hearts-3d-dream-drop-distancerelease-dateSquare-EnixThu, 05 Apr 2012 12:15:00 EST<![CDATA[Theatrhythm Final Fantasy taps in July 3]]>http://www.joystiq.com/2012/04/05/theatrhythm-final-fantasy-taps-in-july-3/http://www.joystiq.com/2012/04/05/theatrhythm-final-fantasy-taps-in-july-3/http://www.joystiq.com/2012/04/05/theatrhythm-final-fantasy-taps-in-july-3/#comments Theatrhythm (pronounced as two words: theater and rhythm): Final Fantasy (also, two words) will make its way to North American shelves on July 3. Square Enix reiterated that the title will launch with 70 scores spanning 25 years of the Final Fantasy franchise.

PAX East attendees can check the 3DS game out by heading over to booth 850.

Gallery: Theatrhythm Final Fantasy

Continue reading Theatrhythm Final Fantasy taps in July 3

JoystiqTheatrhythm Final Fantasy taps in July 3 originally appeared on Joystiq on Thu, 05 Apr 2012 09:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3dsnintendorelease dateReleaseDateSquare-Enixtheatrhythm-final-fantasyThu, 05 Apr 2012 09:45:00 EST<![CDATA[Deus Ex: Human Revolution sneaks to Mac on April 26]]>http://www.joystiq.com/2012/04/04/deus-ex-human-revolution-sneaks-to-mac-on-april-26/http://www.joystiq.com/2012/04/04/deus-ex-human-revolution-sneaks-to-mac-on-april-26/http://www.joystiq.com/2012/04/04/deus-ex-human-revolution-sneaks-to-mac-on-april-26/#comments Square Enix is preparing Deus Ex: Human Revolution for an April 26 launch on Mac, finally bringing raspy cyber-puncher Adam Jensen to the platform.

The Deus Ex: Human Revolution "Ultimate Edition" contains the retail game along with the Missing Link DLC, and the Mission and Tactical Enhancement packs. In addition to those perks, the Ultimate Edition also comes with the soundtrack, an art book, a making-of documentary, motion comic, animated storyboard and CGI trailer.

In other words, it's the "Augmented Edition" with the Missing Link DLC.

JoystiqDeus Ex: Human Revolution sneaks to Mac on April 26 originally appeared on Joystiq on Wed, 04 Apr 2012 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>deus-ex-human-revolutiondeus-ex-human-revolution-ultimate-editioneidos-montrealmacmissing-linksquare-enixWed, 04 Apr 2012 18:00:00 EST<![CDATA[Quantum Conundrum gets an extra Q]]>http://www.joystiq.com/2012/04/04/quantum-conundrum-gets-an-extra-q/http://www.joystiq.com/2012/04/04/quantum-conundrum-gets-an-extra-q/http://www.joystiq.com/2012/04/04/quantum-conundrum-gets-an-extra-q/#comments Image
Square Enix is moving away from the paltry world of dimension-based reveals, announcing actor John De Lancie as one of Quantum Conundrum's main actors. De Lancie is, of course, known for his part as "Q" in the James Bond series, aiding Bond in his interstellar travels of exploration and diplomacy. Or he was a popular Star Trek character -- one of the two.

Anyway, De Lancie is playing the part of Professor Fitz Quadrangle, advising the main character on gameplay and ushering story points forward (he is, after all, stuck in an alternate dimension, anxiously awaiting your help). De Lancie details his role and offers a taste of his voice work in the latest teaser, seen above.

JoystiqQuantum Conundrum gets an extra Q originally appeared on Joystiq on Wed, 04 Apr 2012 16:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>airtight-gamesgameplayjohn-de-lanciemicrosoftpcplaystationps3quantum-conundrumsquare-enixteasertrailervoice-actingvoiceoverxboxWed, 04 Apr 2012 16:00:00 EST<![CDATA[Heroes of Ruin wrecking shop on June 26]]>http://www.joystiq.com/2012/04/04/heroes-of-ruin-wrecking-shop-on-june-26/http://www.joystiq.com/2012/04/04/heroes-of-ruin-wrecking-shop-on-june-26/http://www.joystiq.com/2012/04/04/heroes-of-ruin-wrecking-shop-on-june-26/#comments
Heroes of Ruin will bring co-op dungeon crawling to 3DS on June 26, Square Enix announced today. If you want a chance to play it before then, Square will exhibit the game at PAX East this weekend.

If you want a less hands-on preview, the above video introduces the "Alchitect" character class, whose name is not a typo.

Continue reading Heroes of Ruin wrecking shop on June 26

JoystiqHeroes of Ruin wrecking shop on June 26 originally appeared on Joystiq on Wed, 04 Apr 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3dsheroes-of-ruinn-spacenintendonspaceq2-2012release-datesquare-enixWed, 04 Apr 2012 15:00:00 EST<![CDATA[The Final Fantasy wears Prada]]>http://www.joystiq.com/2012/04/04/the-final-fantasy-wears-prada/http://www.joystiq.com/2012/04/04/the-final-fantasy-wears-prada/http://www.joystiq.com/2012/04/04/the-final-fantasy-wears-prada/#comments ImageSquare Enix revealed this morning that the latest issue of male fashion mag Arena Homme+ features the cast of Final Fantasy XIII-2 in... Prada's 2012 Spring/Summer men's collection.

The issue goes on sale April 12 and features Lightning, Noel, Snow, Sazh and Hope in Prada, which is certainly an upgrade from wearing all those clothes with extraneous buckles. (Note: Buckles are for belts, not hats, shoes or sleeve liners.)

"I've always been interested by the power of video games and their place in society, and the amount of work that's gone into this project blows my mind. We're incredibly pleased with the result," Max Pearmain, Editor of Arena Homme+, said of the collaboration.

This isn't the first time designer fashion and video games have collided, but this one is most clearly intentional -- unlike Dance Central's Lanvin ad and the whole Pyramid Head model thing.

Gallery: Final Fantasy XIII-2 (Prada 2012 Men's Spring/Summer Collection)

JoystiqThe Final Fantasy wears Prada originally appeared on Joystiq on Wed, 04 Apr 2012 08:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>arena-hommearena-homme+bizarreclothingcrosspromotionfinal-fantasy-xiii-2max-pearmainPradaSquare-EnixWed, 04 Apr 2012 08:30:00 EST<![CDATA[Square Enix summons a class-based action title in Crystal Conquest]]>http://www.joystiq.com/2012/04/03/square-enix-summons-a-class-based-action-title-in-crystal-conque/http://www.joystiq.com/2012/04/03/square-enix-summons-a-class-based-action-title-in-crystal-conque/http://www.joystiq.com/2012/04/03/square-enix-summons-a-class-based-action-title-in-crystal-conque/#comments ImageLast week Square Enix's mystery title was outed as Crystal Conquest, a Flash-based action title for Japanese consumption, set to launch this summer. Details are now sidling out, as noted by 4gamer and translated by Andriasang:

Crystal Conquest is a side-scroller with characters shifting between two planes of play, it uses mouse controls only, and it has four classes: Warrior, Scout, Priest and Sorcerer. The goal is to destroy the enemy's home base before time runs out or the enemy destroys yours. At the end of the match, damage and enemies killed are added up and the winner crowned. The battle edifices are called Arrow Tower, Crystals and Summons Facilities, and the title will include classic Square Enix summons functions.

The full list of Crystal Conquest details and a few high-res screens can be peeped right here.

JoystiqSquare Enix summons a class-based action title in Crystal Conquest originally appeared on Joystiq on Tue, 03 Apr 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>actioncrystal-conquestflashflash-gameJapanpcSquare-EnixTue, 03 Apr 2012 18:30:00 EST<![CDATA[Square Enix's mystery game is browser-based Crystal Conquest]]>http://www.joystiq.com/2012/03/30/square-enixs-mystery-game-is-browser-based-crystal-conquest/http://www.joystiq.com/2012/03/30/square-enixs-mystery-game-is-browser-based-crystal-conquest/http://www.joystiq.com/2012/03/30/square-enixs-mystery-game-is-browser-based-crystal-conquest/#comments The fantasy game teased by Square Enix recently is called Crystal Conquest, the company revealed today. It's a browser game for the Japanese Yahoo! Games service, which seems to combine real-time strategy and action.

Two teams of 20 players, trying to defeat one another using summoned creatures and special abilities in a side-scrolling brawler-type environment. Players can assign those skills from decks of cards they've assembled before going into battle.

Square Enix will hold an alpha test for the game from April 12 through April 16, for which it's taking email signups through April 9. The game will be available to all (in Japan) this summer.

JoystiqSquare Enix's mystery game is browser-based Crystal Conquest originally appeared on Joystiq on Fri, 30 Mar 2012 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>browsercrystal-conquestjapanpcsquare-enixsummer-2012yahoo-gamesFri, 30 Mar 2012 12:30:00 EST<![CDATA[Try Hitman, Theatrhythm, and more Square games at PAX East]]>http://www.joystiq.com/2012/03/29/try-hitman-theatrhythm-and-more-square-games-at-pax-east/http://www.joystiq.com/2012/03/29/try-hitman-theatrhythm-and-more-square-games-at-pax-east/http://www.joystiq.com/2012/03/29/try-hitman-theatrhythm-and-more-square-games-at-pax-east/#comments PAX East attendees will have plenty of Square Enix-themed stuff to do -- which probably won't conflict with your most important appointment. Visitors to the company's booth will get to try two anticipated 3DS games: Heroes of Ruin and the just-announced Theatrhythm Final Fantasy, along with Sleeping Dogs, Quantum Conundrum, Risen 2, and Wakfu, which can't possibly be as much fun as its own name.

To learn more about shooting people (in Square Enix games), you can also attend a Hitman: Absolution panel and gameplay demo on Saturday, and a Hitman/Sleeping Dogs party on Friday night. Find more details after the break.

Continue reading Try Hitman, Theatrhythm, and more Square games at PAX East

JoystiqTry Hitman, Theatrhythm, and more Square games at PAX East originally appeared on Joystiq on Thu, 29 Mar 2012 12:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3dshitman-absolutionmicrosoftnintendopax-eastpax-east-2012playstationps3sleeping-dogssquare-enixxboxThu, 29 Mar 2012 12:30:00 EST<![CDATA[Portabliss: Chaos Rings 2 (iOS)]]>http://www.joystiq.com/2012/03/28/portabliss-chaos-rings-2-ios/http://www.joystiq.com/2012/03/28/portabliss-chaos-rings-2-ios/http://www.joystiq.com/2012/03/28/portabliss-chaos-rings-2-ios/#commentsDid you know that you can download handheld games now? That's amazingly convenient! The only inconvenient part of it is finding the right games to buy -- and that's where we come in, with our Portabliss column. In each installment, we'll tell you about a downloadable game on the iPhone, iPad, Android device, DSi, 3DS, PSP, etc. Today: Chaos Rings 2.
During GDC this year, Cave Vice-President Mikio Watanabe implored smartphone and tablet game developers to price their products appropriately: a high-quality game should come with a higher pricetag. Square Enix's Chaos Rings 2 certainly follows Watanabe's advice.

At $18 on iPhone and $20 on iPad, it's among the higher-priced big-name iOS releases. But that old adage of "getting what you pay for" applies, too, as Chaos Rings II is a superb RPG that easily justifies its premium pricetag.

Gallery: Chaos Rings 2 (iOS)

Continue reading Portabliss: Chaos Rings 2 (iOS)

JoystiqPortabliss: Chaos Rings 2 (iOS) originally appeared on Joystiq on Wed, 28 Mar 2012 21:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>iosipadiphonemedia-visionmedia.visionmobileportablisssquare-enixWed, 28 Mar 2012 21:00:00 EST<![CDATA[Square Enix teases unidentified fantasy game for summer]]>http://www.joystiq.com/2012/03/23/square-enix-teases-unidentified-fantasy-game-for-summer/http://www.joystiq.com/2012/03/23/square-enix-teases-unidentified-fantasy-game-for-summer/http://www.joystiq.com/2012/03/23/square-enix-teases-unidentified-fantasy-game-for-summer/#comments
Square Enix is teasing some kind of mystery game -- in that the identity of the game is a mystery, not that it's about solving mysteries. We don't know; it could be that too.

What we do know is that the teaser site has the URL "cc2012.square-enix.co.jp," which may be a clue. The video features fantasy-style characters, crystals, and art by Castlevania: Order of Ecclesia artist Masaki Hirooka and longtime Square artist Yusuke Naora. It's also given a "summer 2012" date.

Our guess is that it's some kind of new mobile/iOS RPG like the Chaos Rings series (on which Naora works). We'll find out more when Square Enix is ready to stop teasing us.

JoystiqSquare Enix teases unidentified fantasy game for summer originally appeared on Joystiq on Fri, 23 Mar 2012 19:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>masaki-hirookasquare-enixyusuke-naoraFri, 23 Mar 2012 19:15:00 EST<![CDATA[Steam weekend sale on Square Enix catalog, Hitman special deal today]]>http://www.joystiq.com/2012/03/22/steam-weekend-sale-on-square-enix-catalog-hitman-special-deal-t/http://www.joystiq.com/2012/03/22/steam-weekend-sale-on-square-enix-catalog-hitman-special-deal-t/http://www.joystiq.com/2012/03/22/steam-weekend-sale-on-square-enix-catalog-hitman-special-deal-t/#comments The entire catalog of Square Enix titles on Steam is half off for the entire weekend, with daily deals today through Sunday on top of that already ridiculous sale. Today, the complete Hitman franchise is 75 percent off, at $6.25 for Codename 47, Blood Money and Silent Assassin.

The Square Enix Hit Collection, which includes Deus Ex: Human Revolution, Lara Croft and the Guardian of Light, Thief: Deadly Shadows and more, is 76 percent off today, for $75 instead of the standard $314.

JoystiqSteam weekend sale on Square Enix catalog, Hitman special deal today originally appeared on Joystiq on Thu, 22 Mar 2012 17:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>deus-ex-human-revolutionHitmanHitman-Blood-Moneylara-croft-and-the-guardian-of-lightmicrosoftpcplaystationps3PublishersaleSquare-EnixSTEAMthief-deadly-shadowsweekend-salexboxThu, 22 Mar 2012 17:30:00 EST<![CDATA[Theatrhythm Final Fantasy serenades the west this summer]]>http://www.joystiq.com/2012/03/22/theatrhythm-final-fantasy-serenades-the-west-this-summer/http://www.joystiq.com/2012/03/22/theatrhythm-final-fantasy-serenades-the-west-this-summer/http://www.joystiq.com/2012/03/22/theatrhythm-final-fantasy-serenades-the-west-this-summer/#comments The adorable Final Fantasy rhythm-action game for 3DS is coming to North America and Europe. And yes, it's still called Theatrhythm: Final Fantasy ("pronounced 'theater rhythm,'" Square Enix explains.) The publisher announced plans to localize the franchise-celebrating music game today, bringing along "more than 70 musical scores spanning 25 years."

Players will tap and drag to the beat of classic Final Fantasy music in modes inspired by "battle," "event" (cutscene), and "field" sequences. Square Enix has dated the release for Summer in both North America and PAL regions. You can relax in the sun this summer, tapping glowing icons over Tidus's face.

Gallery: Theatrhythm Final Fantasy

Continue reading Theatrhythm Final Fantasy serenades the west this summer

JoystiqTheatrhythm Final Fantasy serenades the west this summer originally appeared on Joystiq on Thu, 22 Mar 2012 10:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>3dsindieszeronintendorelease-datesquare-enixsummer-2012theatrhythm-final-fantasyThu, 22 Mar 2012 10:00:00 EST<![CDATA[Trademark filing suggests new Mini Ninjas game]]>http://www.joystiq.com/2012/03/14/trademark-filing-suggests-new-mini-ninjas-game/http://www.joystiq.com/2012/03/14/trademark-filing-suggests-new-mini-ninjas-game/http://www.joystiq.com/2012/03/14/trademark-filing-suggests-new-mini-ninjas-game/#comments It appears that Square Enix may be planning another game filled with tiny assassins. A European trademark filing suggests the publisher is developing a new Mini Ninjas game, titled Mini Ninjas: Hiro's Adventure. Adding to the evidence, Square has also registered a web domain under the same name.

The original Mini Ninjas (pictured) was released in 2009, though it's also coming to Google's Chrome web browser soon. The web app is currently available in beta.

JoystiqTrademark filing suggests new Mini Ninjas game originally appeared on Joystiq on Wed, 14 Mar 2012 18:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>io-interactivemini-ninjasmini-ninjas-hiros-adventuresquare-enixtrademarkWed, 14 Mar 2012 18:30:00 EST<![CDATA[Fight Jihl Nabaat in latest Final Fantasy XIII-2 DLC]]>http://www.joystiq.com/2012/03/11/fight-jihl-nabaat-in-latest-final-fantasy-xiii-2-dlc/http://www.joystiq.com/2012/03/11/fight-jihl-nabaat-in-latest-final-fantasy-xiii-2-dlc/http://www.joystiq.com/2012/03/11/fight-jihl-nabaat-in-latest-final-fantasy-xiii-2-dlc/#comments We're used to seeing names in Final Fantasy XIII and its sequel that don't quite qualify as "words" -- things like "fal'Cie" and "Gran Pulse" -- so we don't blink at the announcement of FFXIII-2 DLC featuring the character "Jihl Nabaat."

The FFXIII enemy will be available as a new coliseum opponent this week. Like other coliseum DLC, it will be possible to recruit her into your party after defeating her in battle. The DLC will be released next week on Xbox 360 and PS3 for 240 Microsoft Points/£1.59, which should come to $3 in North America. And Square Enix also announced future DLC called "Lightning's Story: Requiem of the Goddess" coming "soon."

JoystiqFight Jihl Nabaat in latest Final Fantasy XIII-2 DLC originally appeared on Joystiq on Sun, 11 Mar 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dlcfinal-fantasy-xiii-2jihl-nabaatmicrosoftplaystationps3square-enixxboxSun, 11 Mar 2012 15:00:00 EST<![CDATA[Sleeping Dogs sets the scene with new story trailer]]>http://www.joystiq.com/2012/03/02/sleeping-dogs-sets-the-scene-with-new-story-trailer/http://www.joystiq.com/2012/03/02/sleeping-dogs-sets-the-scene-with-new-story-trailer/http://www.joystiq.com/2012/03/02/sleeping-dogs-sets-the-scene-with-new-story-trailer/#comments
If this story trailer for Sleeping Dogs has taught us anything, it's that the tattoo industry in Asia is booming right now.

JoystiqSleeping Dogs sets the scene with new story trailer originally appeared on Joystiq on Fri, 02 Mar 2012 23:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>microsoftpcplaystationps3sleeping-dogssquare-enixsquare-enix-london-studiosunited-front-gamesxboxFri, 02 Mar 2012 23:00:00 EST<![CDATA[Deus Ex: Human Revolution PC players complain of stuttering, request patch]]>http://www.joystiq.com/2012/03/01/deus-ex-human-revolution-pc-players-complain-of-stuttering-req/http://www.joystiq.com/2012/03/01/deus-ex-human-revolution-pc-players-complain-of-stuttering-req/http://www.joystiq.com/2012/03/01/deus-ex-human-revolution-pc-players-complain-of-stuttering-req/#comments Several users have complained about a persistent issue in Deus Ex: Human Revolution on the PC -- an issue that Square Enix and Eidos Montreal have not addressed yet, according to emails from our readers. Users have complained of in-game stuttering, even with lowered graphical settings, and say these issue have persisted since launch.

Threads on the Steam and Eidos forums have languished since being posted in August, with no official response from Eidos despite each still being active with user complaints. We've contacted Square Enix, who acquired Eidos back in 2009, to find out if there are any plans to address ongoing complaints.

JoystiqDeus Ex: Human Revolution PC players complain of stuttering, request patch originally appeared on Joystiq on Thu, 01 Mar 2012 03:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>deus-ex-human-revolutioneidos-montrealglitchpatchpcsquare-enixstutteringThu, 01 Mar 2012 03:45:00 EST