Joystiq http://www.joystiq.com Joystiq http://www.blogsmithmedia.com/http://www.joystiq.com/media/feedlogo.gif Joystiq http://www.joystiq.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Dyad coming to Steam, GOG this Wednesday]]>http://www.joystiq.com/2013/04/20/dyad-coming-to-steam-gog-this-wednesday/http://www.joystiq.com/2013/04/20/dyad-coming-to-steam-gog-this-wednesday/http://www.joystiq.com/2013/04/20/dyad-coming-to-steam-gog-this-wednesday/#comments
Psychedelic particle physics collider/shooter Dyad will be available on PC through Steam and GOG this Wednesday, April 24, developer Shawn McGrath has announced on Twitter. As stated in the above announcement video, McGrath is well aware that he missed his original target launch window of March - raising a newborn child takes up a lot of your time, as it turns out.

The game will be 10-percent off on both Steam and GOG during the first week of its availability, but folks that pre-order through GOG will save 20 percent.

JoystiqDyad coming to Steam, GOG this Wednesday originally appeared on Joystiq on Sat, 20 Apr 2013 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dyadpcrelease-dateright-square-bracket-left-square-bracketshawn-mcgrathSat, 20 Apr 2013 18:00:00 EST<![CDATA[Dyad makes a break for Steam, targets March launch [Update: Dev video]]]>http://www.joystiq.com/2013/02/04/dyad-makes-a-break-for-steam-targets-march-launch/http://www.joystiq.com/2013/02/04/dyad-makes-a-break-for-steam-targets-march-launch/http://www.joystiq.com/2013/02/04/dyad-makes-a-break-for-steam-targets-march-launch/#comments
Dyad is coming to Steam for PC, Mac and Linux, developer Shawn McGrath confirms to Joystiq. Dyad was spotted on a list of new titles buried deep within the recesses of the Steam database, and it appears the secret is now out.

"This was a rather interesting thing that happened," McGrath says. "I didn't plan on announcing Dyad on Steam yet, but what can I do now?"

McGrath has been talking with Valve since March 2012 about getting Dyad on Steam, but nothing was certain until October. He hopes to have it out in March, "but who knows when it'll actually come out?" McGrath says. He'd like to launch Dyad on PC, Mac and Linux simultaneously, but it's possible the PC version will drop first.

The Steam version will be identical to 2012's PS3 iteration, since McGrath says he feels that one is complete. Dyad made a psychedelic splash on PSN last year and we summed up its experience in one phrase and a lot of stars: "Dyad is magic."

Update: The video embedded above is McGrath's official announcement, and we guarantee it's the best surprise-Steam-release film featuring a dude with a killer beard you'll see all day.

JoystiqDyad makes a break for Steam, targets March launch [Update: Dev video] originally appeared on Joystiq on Mon, 04 Feb 2013 13:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dyadmacpcshawn-mcgrathSTEAMMon, 04 Feb 2013 13:00:00 EST<![CDATA['A Game About Bouncing' from Dyad dev coming to PlayStation Home]]>http://www.joystiq.com/2012/11/05/a-game-about-bouncing-from-dyad-dev-coming-to-playstation-home/http://www.joystiq.com/2012/11/05/a-game-about-bouncing-from-dyad-dev-coming-to-playstation-home/http://www.joystiq.com/2012/11/05/a-game-about-bouncing-from-dyad-dev-coming-to-playstation-home/#comments
PlayStation Home is getting a new arcade game this Wednesday, and this one has some indie chops. From the minds of Dyad, studio ][ and Shawn McGrath, comes A Game About Bouncing, which McGrath briefly discussed in an interview with Joystiq earlier this year. Originally developed as a prototype sketch at a quick game jam, Bouncing is now featured as a premium arcade cabinet in PlayStation Home.

Purchasing the cabinet gives players access to the game along with a full avatar skin, some themed glasses to wear, and even a Shawn McGrath-inspired outfit, complete with cowboy hat and beard.

There's also a bevy of other new avatar items available for purchase, and some tweaks and additions to the Avalon Keep area in Home (including a new crystal-collecting minigame you can play with friends). Sony says the update, including that new arcade cabinet, should be out and available on PlayStation Home on this Wednesday, November 7; however, no price was revealed.

Joystiq'A Game About Bouncing' from Dyad dev coming to PlayStation Home originally appeared on Joystiq on Mon, 05 Nov 2012 20:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>a-game-about-bouncingavalon-keepavatardyadminigameplaystationplaystation-homeps3releaseShawn-McGrathMon, 05 Nov 2012 20:30:00 EST<![CDATA[Deconstructing the Dyad design with creator Shawn McGrath]]>http://www.joystiq.com/2012/07/16/deconstructing-the-dyad-design-with-creator-shawn-mcgrath/http://www.joystiq.com/2012/07/16/deconstructing-the-dyad-design-with-creator-shawn-mcgrath/http://www.joystiq.com/2012/07/16/deconstructing-the-dyad-design-with-creator-shawn-mcgrath/#comments Deconstructing the Dyad design with creator Shawn McGrath
Shawn McGrath, creator of PSN-exclusive tunnel shooter Dyad, exits his workplace - a house in the north side of Toronto - and lights up a cigarette. The rental home is lined with out-of-control weeds McGrath steps over to lean against his car, which sports novelty license plates with a leet variation of the word "hacker."

That was a high school decision, he admits.

Inside the house is a sanctuary for his art, a game McGrath has been working on for years. Dyad, which will be launched tomorrow, was the culmination of a dream McGrath once told himself was dead before reclaiming it with the help of friends; a group deeply rooted in the development of Toronto's burgeoning independent game scene.

But McGrath's obsession with game creation began many years before he, as a preteen, would program his first QBasic title. It was an obsession that began with Tetris.

Gallery: Dyad (PSN)

Continue reading Deconstructing the Dyad design with creator Shawn McGrath

JoystiqDeconstructing the Dyad design with creator Shawn McGrath originally appeared on Joystiq on Mon, 16 Jul 2012 15:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dyadplaystationps3psnShawn-McGrathMon, 16 Jul 2012 15:00:00 EST<![CDATA[Dyad gets kaleidoscopic on PS3 July 17]]>http://www.joystiq.com/2012/07/09/dyad-gets-kaleidoscopic-on-ps3-july-17/http://www.joystiq.com/2012/07/09/dyad-gets-kaleidoscopic-on-ps3-july-17/http://www.joystiq.com/2012/07/09/dyad-gets-kaleidoscopic-on-ps3-july-17/#comments Dyad gets kaleidoscopic on PS3 July 17
You won't have to wait long to find out what Shawn McGrath's PS3-exclusive abstract racing action game Dyad is all about. The PlayStation Blog just revealed that the colorful PSN game will be available July 17.

Well, it might take you a while after it comes out to find out what the game is all about. You'll have to descend into the Dyad fugue state of color-matching, ziplining, and lancing inside a psychedelic space tube, and then reflect on your experiences in the space tube. And then practice.

JoystiqDyad gets kaleidoscopic on PS3 July 17 originally appeared on Joystiq on Mon, 09 Jul 2012 15:07:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dyadplaystationps3psnrelease-dateshawn-mcgrathMon, 09 Jul 2012 15:07:00 EST<![CDATA[Dyad is a mind-altering substance]]>http://www.joystiq.com/2012/03/12/dyad-is-a-mind-altering-substance/http://www.joystiq.com/2012/03/12/dyad-is-a-mind-altering-substance/http://www.joystiq.com/2012/03/12/dyad-is-a-mind-altering-substance/#comments
Following the completion of my Dyad demo in a darkened hotel room, I was informed by developer Shawn McGrath that I had likely just experienced synaesthesia. He asked if I'd heard the music change when the visuals abruptly changed, which I had. He then told me the music didn't actually change, meaning that I'd heard the visual effects. My senses had become tangled.

McGrath said this was an unintentional side effect of the way he designed the last level (which he had skipped ahead to show me). Without spoiling it, I'll say that Dyad's ending is a protracted sequence of total visual hypnosis, interrupted only by my pause halfway through to wipe my eyes. Turns out I hadn't been blinking and my eye became irritated and watery.

Gallery: Dyad (PSN)

Continue reading Dyad is a mind-altering substance

JoystiqDyad is a mind-altering substance originally appeared on Joystiq on Mon, 12 Mar 2012 16:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>dyadgdc-2012playstationps3psnshawn-mcgrathMon, 12 Mar 2012 16:30:00 EST