Joystiq http://www.joystiq.com Joystiq http://www.blogsmithmedia.com/http://www.joystiq.com/media/feedlogo.gif Joystiq http://www.joystiq.com en-us Copyright 2009 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Left 4 Dead 2 patch on PC now, Xbox 360 'later this month']]>http://www.joystiq.com/2009/12/10/left-4-dead-2-patch-on-pc-now-xbox-360-later-this-month/http://www.joystiq.com/2009/12/10/left-4-dead-2-patch-on-pc-now-xbox-360-later-this-month/http://www.joystiq.com/2009/12/10/left-4-dead-2-patch-on-pc-now-xbox-360-later-this-month/#comments In its ongoing support of Left 4 Dead 2 on the PC, Valve has issued another patch for the game, fixing a number of problems including physics crashes and hit boxes on the Charger, Jockey and Spitter. Some of the exploits PC gamers have stumbled upon have also been eradicated, including incapped survivors improving their weapon accuracy by holding the crouch button -- though we wouldn't call that an exploit so much as a natural evolution in the face of the zombie threat. Good, old-fashioned human ingenuity is what will win us this war, people!

You can head past the break for the full patch notes. An update for the Xbox 360 will be available "later this month."

Continue reading Left 4 Dead 2 patch on PC now, Xbox 360 'later this month'

JoystiqLeft 4 Dead 2 patch on PC now, Xbox 360 'later this month' originally appeared on Joystiq on Thu, 10 Dec 2009 14:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>fpsleft-4-deadleft-4-dead-2patchsteamupdatevalvezombiesThu, 10 Dec 2009 14:00:00 EST<![CDATA[Street artists beef up billboards with Doom graphics]]>http://www.joystiq.com/2009/12/09/street-artists-beef-up-billboards-with-doom-graphics/http://www.joystiq.com/2009/12/09/street-artists-beef-up-billboards-with-doom-graphics/http://www.joystiq.com/2009/12/09/street-artists-beef-up-billboards-with-doom-graphics/#comments
[Flickr user Mr. Talion]
You know what? Driving around is boring. Luckily, some Germans are taking steps to amp up the experience by incorporating Doom graphics into billboard ads, effectively upping their cool factor exponentially. Check out this Flickr set and tell us these billboards are anything but completely awesome. We dare you!

Hopefully, this is the beginning of a trend that will cross the oceans of the world and spread throughout every major city, causing us to actually care about these outdoor advertising eyesores. In the spirit of international sharing, we've got a couple ideas of our own you can check out past the break.

[Via Animal New York and Nerdcore; thanks, Ryan]

Continue reading Street artists beef up billboards with Doom graphics

JoystiqStreet artists beef up billboards with Doom graphics originally appeared on Joystiq on Wed, 09 Dec 2009 16:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>billboardbillboardsbubsydoomdsgduke-nukemWed, 09 Dec 2009 16:00:00 EST<![CDATA[Smithsonian exhibit 'The Art of Video Games' opens in 2012]]>http://www.joystiq.com/2009/12/08/smithsonian-exhibit-the-art-of-video-games-opens-in-2012/http://www.joystiq.com/2009/12/08/smithsonian-exhibit-the-art-of-video-games-opens-in-2012/http://www.joystiq.com/2009/12/08/smithsonian-exhibit-the-art-of-video-games-opens-in-2012/#comments From March 16, 2012 until September 9, 2012, the US's popular Smithsonian museum will be showcasing something patrons aren't used to seeing in such an environment: video games. Sure, we've seen video game art exhibitions before, but the Smithsonian exhibit will attempt to be "the first to examine comprehensively the evolution of video games themselves as an artistic medium."

The exhibit, The Art of Video Games, will feature game footage, video interviews with artists and game developers, a history of game consoles and even a few consoles for visitors to play. The museum will also welcome suggestions from attendees and tap Chris Melissinos as guest curator for the exhibit. Our first suggestion for the Smithsonian: hit up Krix for some of his amazing props.

[Thanks, MowDownJoe]

JoystiqSmithsonian exhibit 'The Art of Video Games' opens in 2012 originally appeared on Joystiq on Tue, 08 Dec 2009 20:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>artculturemuseumsmithsonianthe-art-of-video-gamesTue, 08 Dec 2009 20:00:00 EST<![CDATA[Mod adds Travis Touchdown to Team Fortress 2, Left 4 Dead]]>http://www.joystiq.com/2009/12/07/mod-adds-travis-touchdown-to-team-fortress-2-left-4-dead/http://www.joystiq.com/2009/12/07/mod-adds-travis-touchdown-to-team-fortress-2-left-4-dead/http://www.joystiq.com/2009/12/07/mod-adds-travis-touchdown-to-team-fortress-2-left-4-dead/#comments
 No More Heroes' girl-crazy otaku protagonist, Travis Touchdown, must have found the Cosmic Key, because he's crossed over into the world of Valve games -- specifically Left 4 Dead and Team Fortress 2.

The L4D mod uses Travis to meet the game's quota for one leather-clad survivor, putting him, in his usual red jacket and Pure White Lover Bizarre Jelly T-shirt (but no beam katana), in the place of ultra-pessimist Francis. While an L4D2 mod could address the lack of stabbing and cutting, it would seem mod creator ash_link isn't a fan of Valve's sequel, so, yeah ... that's probably not happening.

The Team Fortress 2 mod does about the same thing, replacing that game's Scout with a pint-sized, katana-wielding Touchdown. Head past the break to see for yourself. Seriously, go watch the video now.

[Via Destructoid]

Continue reading Mod adds Travis Touchdown to Team Fortress 2, Left 4 Dead

JoystiqMod adds Travis Touchdown to Team Fortress 2, Left 4 Dead originally appeared on Joystiq on Mon, 07 Dec 2009 17:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>left-4-deadleft-4-dead-2modno-more-heroesteam-fortress-2travis-touchdownvalveMon, 07 Dec 2009 17:00:00 EST<![CDATA[Modern Warfare 2 update 1.06 fixes Javelin glitch, infinite care packages, geography exploits]]>http://www.joystiq.com/2009/12/07/modern-warfare-2-update-1-06-fixes-javelin-glitch-infinite-care/http://www.joystiq.com/2009/12/07/modern-warfare-2-update-1-06-fixes-javelin-glitch-infinite-care/http://www.joystiq.com/2009/12/07/modern-warfare-2-update-1-06-fixes-javelin-glitch-infinite-care/#comments If amazingly fast and explosive men have been the bane of your existence in Modern Warfare 2 as of late, then know that Activision's go-to guy, Robert "fourzerotwo" Bowling, has got the hot scoops on a patch in the works to address the despised Javelin glitch. Version 1.06 of the game will not only do away with that awful bit of frustration, but will also address two other notable exploits in the multiplayer experience:
  • Fixes the Javelin glitch (thank the Flying Spaghetti Monster!)
  • Fixes unlimited care packages glitch
  • Fixes areas where players could exploit geography (e.g. hide inside rocks in Afghan)
Bowling says the patch is currently in the hands of Microsoft for certification on Xbox 360 and presumably in Sony's for PS3 certification. We've contacted Bowling for more info and will update the post when we hear back.

Source - 1.06 in Microsoft cert
Source - 1.06 patch notes

JoystiqModern Warfare 2 update 1.06 fixes Javelin glitch, infinite care packages, geography exploits originally appeared on Joystiq on Mon, 07 Dec 2009 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>call-of-dutycall-of-duty-modern-warfare-2exploitglitchinfinity-wardjavelinjavelin-glitchmodern-warfare-2multiplayerpsnxbox-liveMon, 07 Dec 2009 15:30:00 EST<![CDATA[NintendoWare Weekly: Rayman, Stop Stress, Shinobi, Street Fighter Alpha 2]]>http://www.joystiq.com/2009/12/07/nintendoware-weekly-rayman-stop-stress-shinobi-street-fighte/http://www.joystiq.com/2009/12/07/nintendoware-weekly-rayman-stop-stress-shinobi-street-fighte/http://www.joystiq.com/2009/12/07/nintendoware-weekly-rayman-stop-stress-shinobi-street-fighte/#comments There's some classic platforming to be had in both Rayman and Shinobi in this week's Nintendo downloads, and even a way to deal with Jack's overabundance of stress in Stop Stress: A Day of Fury. There's over ten titles in all, so cruise past the break for the full list.

Continue reading NintendoWare Weekly: Rayman, Stop Stress, Shinobi, Street Fighter Alpha 2

JoystiqNintendoWare Weekly: Rayman, Stop Stress, Shinobi, Street Fighter Alpha 2 originally appeared on Joystiq on Mon, 07 Dec 2009 10:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>army-defenderball-fightercapcomdsidsiwareflowerworksmagnetismy-dolphinmynotebooknintendo-dsinintendoware-weeklypop-islandraymanshinobisnesstop-stressstreet-fighterstreet-fighter-alphastreet-fighter-alpha-2ubisoftvc-arcadevirtual-consolewiiwareMon, 07 Dec 2009 10:30:00 EST<![CDATA[Assassin's Creed 2 glitch breaks the game [update]]]>http://www.joystiq.com/2009/12/04/rumor-assassins-creed-2-glitch-breaks-the-game/http://www.joystiq.com/2009/12/04/rumor-assassins-creed-2-glitch-breaks-the-game/http://www.joystiq.com/2009/12/04/rumor-assassins-creed-2-glitch-breaks-the-game/#comments Now that Assassin's Creed II has been out amongst the crowds, slinking its way into millions of consoles, gamers are stumbling upon some of its secrets. While you may be stuck tracking down those last few feathers, others are discovering ancient beasts and, according to CVG, game-breaking glitches.

Some gamers apparently found themselves stuck controlling Desmond in the Hideout after DNA Sequence 11, a direct result of shutting off their system after the game autosaved. When they later booted the game back up, they were unable to return to the Animus and continue Ezio's 15th century adventure. CVG didn't comment on whether this was affecting Xbox 360 or PS3 gamers, or both.

We've contacted Ubisoft to see if this is the first it's heard of the issue and also urge you to contact us if you've encountered it.

Update: Ubisoft has acknowledged the "SQ11" glitch. Posting on the company's message boards, community developer "Atmon" confirmed that Ubisoft is aware of the issue and is "glad to say that it will be solved through our upcoming patch," but did not suggest a release date for said patch. In a separate thread, Atmon continued to dance around the issue of a release date for the patch, explaining that upcoming server maintenance is unrelated to fixing the glitch.

JoystiqAssassin's Creed 2 glitch breaks the game [update] originally appeared on Joystiq on Fri, 04 Dec 2009 19:05:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>assassins-creedassassins-creed-2glitchubisoftubisoft-montrealFri, 04 Dec 2009 19:05:00 EST<![CDATA[No More Heroes: Heroes' Paradise footage is light on gameplay, heavy on badassery]]>http://www.joystiq.com/2009/12/04/no-more-heroes-heroes-paradise-footage-is-light-on-gameplay-h/http://www.joystiq.com/2009/12/04/no-more-heroes-heroes-paradise-footage-is-light-on-gameplay-h/http://www.joystiq.com/2009/12/04/no-more-heroes-heroes-paradise-footage-is-light-on-gameplay-h/#commentsJapanese publisher Marvelous just uploaded a quite lengthy and quite new trailer for the Xbox 360 and PS3 port of No More Heroes. It's all in Japanese, but it speaks the universal languages of crazy bosses and near-naked-babe quite well.

Aside from that, it also shows how much better the game looks compared to its Wii counterpart -- all of those Ps really make a difference. Be sure to check out the last few seconds of the trailer, which show us the Japanese version of the game just may not be censored after all. The original censored Wii game certainly didn't have that much blood in it!

JoystiqNo More Heroes: Heroes' Paradise footage is light on gameplay, heavy on badassery originally appeared on Joystiq on Fri, 04 Dec 2009 14:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>grasshopper-manufacturemmvno-more-heroessuda-51suda51Fri, 04 Dec 2009 14:30:00 EST<![CDATA[Modern Warfare 2's poor translation, censorship in Japan draws ire]]>http://www.joystiq.com/2009/12/04/modern-warfare-2s-poor-translation-censorship-in-japan-draws-i/http://www.joystiq.com/2009/12/04/modern-warfare-2s-poor-translation-censorship-in-japan-draws-i/http://www.joystiq.com/2009/12/04/modern-warfare-2s-poor-translation-censorship-in-japan-draws-i/#comments When Square Enix enlisted to localize Modern Warfare 2 for Japan, the publisher went above and beyond the call of duty. The game would be issued a complete Japanese-dialog makeover -- whereas the first Modern Warfare localization was simply subtitled -- in response to a "strong desire from Activision to widen the entrance for beginning FPS players," as Square Enix told Famitsu. However, some gamers are reporting that the extra effort has fallen short, citing numerous translation errors in the localized game. [Insert your Bill Murray joke here.]

Additionally, Japanese site My Game Flash has rounded up other complaints about the localization, most notably an alteration to the sensationalized "No Russian" mission. Rather than delete the mission (as in the censored Russian version), Square Enix had the Japanese version of the mission adjusted to restrict the player from participating in a terrorist assault on an airport. If the player does engage civilian targets, it's game over.

Square Enix has posted an update on the Modern Warfare 2 Japanese site describing the full Japanese language and subtitle tracks and warning of the "No Russian" edits, but has not announced plans to patch the translation errors or change the limitations on the censored mission. The publisher has cited technical limitations, which prevent selectable English and Japanese language tracks. Head past the break to see some footage of the Japanese version of MW2, courtesy of andriasang.

[Via andriasang]

Source - My Game Flash [machine translation]
Source - Famitsu [machine translation]
Source - Modern Warfare 2 Japanese site

Continue reading Modern Warfare 2's poor translation, censorship in Japan draws ire

JoystiqModern Warfare 2's poor translation, censorship in Japan draws ire originally appeared on Joystiq on Fri, 04 Dec 2009 13:28:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>activisioncall-of-dutyfpsinfinity-wardlocalizationlost-in-translationmodern-warfare-2square-enixsubtitlesFri, 04 Dec 2009 13:28:00 EST<![CDATA[GOG.com gets Cyan Worlds' Myst games]]>http://www.joystiq.com/2009/12/04/gog-com-gets-cyan-worlds-myst-games/http://www.joystiq.com/2009/12/04/gog-com-gets-cyan-worlds-myst-games/http://www.joystiq.com/2009/12/04/gog-com-gets-cyan-worlds-myst-games/#comments
If you consider the daily crossword puzzle a suitable mental exercise routine, then, buddy, you've got it all wrong. That's child's play for baby brains and yours needs a bit more stimulation than that. Thankfully, GoG.com is here to put a few wrinkles in all the right spots, as it's announced Cyan Worlds' beloved Myst series is coming to its library of DRM-free titles.

You can actually check out Myst: Masterpiece Edition right now for $5.99, but you'll have to wait a bit for Riven: The Sequel to Myst and The Manhole: Masterpiece Edition -- the latter of which is admittedly not part of Myst canon, but comes from the Myst creators and should interest fans nonetheless. Both will also be priced at $5.99 and can be yours "soon."

JoystiqGOG.com gets Cyan Worlds' Myst games originally appeared on Joystiq on Fri, 04 Dec 2009 06:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>cyan-worldsdrmgoggog.comgood-old-gamesmystriventhe-manholeFri, 04 Dec 2009 06:30:00 EST<![CDATA[THQ to open new Montreal studio]]>http://www.joystiq.com/2009/12/03/thq-to-open-new-montreal-studio/http://www.joystiq.com/2009/12/03/thq-to-open-new-montreal-studio/http://www.joystiq.com/2009/12/03/thq-to-open-new-montreal-studio/#comments The city of Montreal can add another gaming studio to its ranks, as THQ has announced plans for its biggest studio yet: THQ Montreal. The new development house will focus on "creating core games for THQ" and assisting with titles developed by the company's other studios worldwide. THQ Montreal is expected to create some 400 new jobs in the Quebec province, with THQ's Paradigm Entertainment head, Dave Gatchel, overseeing operations when the studio opens in mid-2010.

THQ VP Steve DeCosta says it's not just the tax breaks that make Montreal such an appealing place to set up shop, but also the talent pool in the region -- sentiments shared by neighboring Ontario minister Sandra Pupatello.

JoystiqTHQ to open new Montreal studio originally appeared on Joystiq on Thu, 03 Dec 2009 21:15:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>canadadave-gatcheldavid-gatchelmontrealparadigm-entertainmentthqthq-montrealThu, 03 Dec 2009 21:15:00 EST<![CDATA[It's in the debt: Introducing the EA Sports prepaid debit card]]>http://www.joystiq.com/2009/12/03/its-in-the-debt-introducing-the-ea-sports-prepaid-debit-card/http://www.joystiq.com/2009/12/03/its-in-the-debt-introducing-the-ea-sports-prepaid-debit-card/http://www.joystiq.com/2009/12/03/its-in-the-debt-introducing-the-ea-sports-prepaid-debit-card/#comments EA Sports wants to get in your wallet. We're talking about the new EA Sports DebitSmart Visa prepaid card. It works like a lot of other prepaid debit cards: you give EA money, it puts that money on the card. However, EA is trying to sweeten the deal (paying money to use money is a deal?) through the inclusion of EA Sports Reward Points, fractions of payments made with the card that are converted to points which consumers can then use toward EA Sports purchases via EA's site.

EA marketing VP Todd Sitrin calls the program "a perfect marriage of encouraging responsible spending while providing a unique reward program." History teaches us otherwise, so if you'll excuse us, we'll just be sitting in the corner, waiting for the other shoe to drop.

JoystiqIt's in the debt: Introducing the EA Sports prepaid debit card originally appeared on Joystiq on Thu, 03 Dec 2009 20:15:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>debit-cardeaea-sportsea-sports-debitsmartea-sports-prepaid-cardprepaid-cardsvisaThu, 03 Dec 2009 20:15:00 EST<![CDATA[Max Payne 3 delayed until late 2010]]>http://www.joystiq.com/2009/12/03/max-payne-3-delayed-to-late-2010/http://www.joystiq.com/2009/12/03/max-payne-3-delayed-to-late-2010/http://www.joystiq.com/2009/12/03/max-payne-3-delayed-to-late-2010/#comments In a new financial earnings and projection report, Take-Two has dished out news of Max Payne 3's release. The game's been pushed back -- we like to imagine in incredibly slow and dramatic fashion -- to the company's fiscal Q4 2010. In real time, that translates to a three-month period spanning August-October, 2010. The game was previously pegged for an unlikely Winter 2009 release.

Based on what we've seen of Max Payne 3 so far, we'd say that bumping back its release is a good move. Max is in serious need of some Jazzercise and a decent dry cleaner, so this extra time will hopefully get him into better shape to handle the countless waves of bad guys he'll be indiscriminately shooting in the face.

JoystiqMax Payne 3 delayed until late 2010 originally appeared on Joystiq on Thu, 03 Dec 2009 17:13:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>delaysmax-paynemax-payne-3release-daterockstartake-twoThu, 03 Dec 2009 17:13:00 EST<![CDATA[Mock the Medal of Honor box art and this man may kill you]]>http://www.joystiq.com/2009/12/03/mock-the-medal-of-honor-box-art-and-this-man-may-kill-you/http://www.joystiq.com/2009/12/03/mock-the-medal-of-honor-box-art-and-this-man-may-kill-you/http://www.joystiq.com/2009/12/03/mock-the-medal-of-honor-box-art-and-this-man-may-kill-you/#comments It seems the cover star for EA reboot Medal of Honor bears quite a resemblance to a real-life military man -- and not the fictional lumberjack uncle we like to think resides in every Canadian family. Life did a feature on the armed forces in Afghanistan back in 2002, and one of the individuals (codenamed "Cowboy") highlighted in several photos (via UGO) seems to match the one highlighted on the FPS cover.

EA did mention working closely with "Tier 1 Operators from the US Special Operations Community," so it seems possible that the main character could be inspired by (if not actually based on) Mr. Cowboy. We've contacted EA to get some intel on this. We'll let you know, if we haven't been taken out for yesterday's ZZ Top joke.

JoystiqMock the Medal of Honor box art and this man may kill you originally appeared on Joystiq on Thu, 03 Dec 2009 17:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>afghanistancowboyeaea-lafpsmedal-of-honorThu, 03 Dec 2009 17:00:00 EST<![CDATA[GameStop beams down Star Trek Online Collector's Edition info (plus, new trailer!)]]>http://www.joystiq.com/2009/12/03/gamestop-beams-down-star-trek-online-collectors-edition-info-p/http://www.joystiq.com/2009/12/03/gamestop-beams-down-star-trek-online-collectors-edition-info-p/http://www.joystiq.com/2009/12/03/gamestop-beams-down-star-trek-online-collectors-edition-info-p/#comments
Klingons aren't the only thing in the galaxy you should fear, as your inner desire for paraphernalia and in-game items could push you over the edge to purchase the Star Trek Online Collector's Edition from GameStop. The online retailer details the $80 package as including a small, metal Communicator Badge, an in-game Red Matter Capacitor that gives all of your ships a little extra energy and exclusive Next Generation and Deep Space Nine uniforms for your crew. You'll also score some guest passes for a few friends and a deluxe, hardcover manual and requisite special packaging.

Above, you can check out a new trailer showing off some of the ship-based combat and, should you desire a look at the full Collector's Edition packaging, you can make it so by engaging past the break.

[Via Big Download]

Continue reading GameStop beams down Star Trek Online Collector's Edition info (plus, new trailer!)

JoystiqGameStop beams down Star Trek Online Collector's Edition info (plus, new trailer!) originally appeared on Joystiq on Thu, 03 Dec 2009 16:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>ataricollectors-editioncrypticcryptic-studiosgamestopmmostar-trek-onlineThu, 03 Dec 2009 16:30:00 EST<![CDATA[Allotment bar in Glasgow pays homage to Pong]]>http://www.joystiq.com/2009/12/03/allotment-bar-in-glasgow-pays-homage-to-pong/http://www.joystiq.com/2009/12/03/allotment-bar-in-glasgow-pays-homage-to-pong/http://www.joystiq.com/2009/12/03/allotment-bar-in-glasgow-pays-homage-to-pong/#comments
You know, the United Kingdom isn't a great place to go if you enjoy drinking. The folks there, they just aren't big drinkers. It's difficult for them to find reasons to partake in the time-traveling powers of alcohol. Enter: Allotment, a new bar in the Glasgow area that offers thirsty patrons live performance art, music and a bit of the in-between.

Right about now, you're probably wondering what this has to do with games. Well, this Saturday, the bar will be transformed into a living dedication to retro gaming, with a central theme of "gaming and morality." There'll be roulette and karaoke, some arcade gaming. But, more importantly, coordinators will envision a real-life Pong tribute in the space, allowing attendees to participate at any time in the recreation by simply walking up and changing it.

If you're looking for more information on Allotment, or tickets to attend, then head on over to the National Theatre of Scotland. If after reading this, you're in the mood to watch that awesome video of Japanese Matrix ping-pong, well ... you aren't the only one.

[Via GamePolitics]

JoystiqAllotment bar in Glasgow pays homage to Pong originally appeared on Joystiq on Thu, 03 Dec 2009 04:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>allotmentartataricultureglasgownational-theatre-of-scotlandperformance-artpongukunited-kingdomThu, 03 Dec 2009 04:00:00 EST<![CDATA[Google Zeitgeist 2009 shows year's top game searches]]>http://www.joystiq.com/2009/12/02/google-zeitgeist-2009-shows-years-top-game-searches/http://www.joystiq.com/2009/12/02/google-zeitgeist-2009-shows-years-top-game-searches/http://www.joystiq.com/2009/12/02/google-zeitgeist-2009-shows-years-top-game-searches/#comments We would never call you out on your love for whatever crappy thing it is that you love but, guys, you're using Google wrong. Its recent Zeitgeist 2009 report shows what the most popular gaming term searches of this year have been and the results are pretty surprising.

At the top spot is Ghostbusters, which is fine by us -- it was a pretty big deal when it was announced and it sold a lot of copies, so naturally folks were interested. But, as we delve deeper into the top 10, the search terms become a bit more interesting. The next three terms -- "ufc" "saw" and "bakugan" -- really threw us for a loop. Saw? Really? Bakugan? What is that, a gun that uses evil Japanese spirits for ammo? Actually, that sounds pretty cool.

Further into the list, we see that Batman: Arkham Asylum managed to put a batarang in the fifth spot, much lower than we'd like, but we can live with that -- however, coming in at the sixth spot is Twilight. Guys! Vampires. Do. Not. Sparkle. Seventh was FIFA 2010, followed by Modern Warfare in eighth. The ninth spot belonged to Transformers 2, which we must admit has one of this year's best performances by a human male, so that seems okay. Finally, Resident Evil 5 rounded out the list in last place.

JoystiqGoogle Zeitgeist 2009 shows year's top game searches originally appeared on Joystiq on Wed, 02 Dec 2009 23:59:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>bakuganbatmanbatman-arkham-asylumfifa-2010ghostbustersgooglegoogle-zeitgeist-2009modern-warfaremodern-warfare-2resident-evil-5sawtransformers-2ufczeitgeistWed, 02 Dec 2009 23:59:00 EST<![CDATA[THQ gains exclusive rights to Dreamworks game tie-ins]]>http://www.joystiq.com/2009/12/02/thq-gains-exclusive-rights-to-dreamworks-game-tie-ins/http://www.joystiq.com/2009/12/02/thq-gains-exclusive-rights-to-dreamworks-game-tie-ins/http://www.joystiq.com/2009/12/02/thq-gains-exclusive-rights-to-dreamworks-game-tie-ins/#comments
THQ is no stranger to producing accessible, fun-for-the-whole-family entertainment and has just inked a deal to acquire exclusive rights to Dreamworks game tie-ins worldwide. This agreement will see THQ produce three titles initially: Kung-Fu Panda 2: The Kaboom of Doom; a game based on upcoming Shrek spin-off, Puss in Boots; and a title based on the animated TV series, The Penguins of Madagascar. That last one sounds a lot more interesting than a game based on Morgan Freeman's penguins, though we must admit, a game based on the French version of that would be fantastique.

But, we digress. THQ also gains rights for "Xbox Live Arcade, PlayStation Network and Nintendo Wii Virtual Console" -- we guess THQ has never heard of WiiWare? The first title to release as a part of this deal, The Penguins of Madagascar, will grace store shelves starting next year, while the other games will release alongside their theatrical counterparts in 2011.

JoystiqTHQ gains exclusive rights to Dreamworks game tie-ins originally appeared on Joystiq on Wed, 02 Dec 2009 22:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>dreamworkskung-fu-pandakung-fu-panda-the-kaboom-of-doompuss-in-bootsthe-penguins-of-madagascarthqWed, 02 Dec 2009 22:00:00 EST<![CDATA[Battlefield 1943, Bad Company 2 system specs revealed]]>http://www.joystiq.com/2009/12/02/battlefield-1943-bad-company-2-system-specs-revealed/http://www.joystiq.com/2009/12/02/battlefield-1943-bad-company-2-system-specs-revealed/http://www.joystiq.com/2009/12/02/battlefield-1943-bad-company-2-system-specs-revealed/#comments
Ten-hut, soldiers! During wartime, the government is granted special powers and as such the Army is going to need to commandeer your personal computers. Before we send our best and brightest out into battle, we'll need to train them in advanced maneuvers via upcoming PC games Battlefield 1943 and Battlefield: Bad Company 2.

Before you start packing up your 'puters, know the government has issued its guidelines for computer operations (via Shacknews). Report past the break to see if your computer meets these stringent requirements.

Continue reading Battlefield 1943, Bad Company 2 system specs revealed

JoystiqBattlefield 1943, Bad Company 2 system specs revealed originally appeared on Joystiq on Wed, 02 Dec 2009 20:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>battlefieldbattlefield-1943battlefield-bad-company-2diceeafrostbytesystem-requirementswindowsWed, 02 Dec 2009 20:00:00 EST<![CDATA[Modern Warfare 2 talent director Keith Arem moves to film]]>http://www.joystiq.com/2009/12/02/modern-warfare-2-talent-director-keith-arem-moves-to-film/http://www.joystiq.com/2009/12/02/modern-warfare-2-talent-director-keith-arem-moves-to-film/http://www.joystiq.com/2009/12/02/modern-warfare-2-talent-director-keith-arem-moves-to-film/#comments
[IMDB]

What do you do once you've directed actors for a game that's piled up millions faster than pretty much everything? Well, if you follow the Keith Arem School of Thought, you move on to directing in film. Variety reports that Arem's just signed on to direct upcoming action-thriller Frost Road -- the story of a man who awakens from a car crash to find the world is infected with a deadly disease to which he is inexplicably immune.

Moving on to movie making is not much of a stretch for Arem, who was the talent director responsible for rounding up actors and coordinating their efforts in Modern Warfare 2. He also penned the script for Frost Road, so we're totally expecting the protagonist to have one bitchin' mustache.

JoystiqModern Warfare 2 talent director Keith Arem moves to film originally appeared on Joystiq on Wed, 02 Dec 2009 19:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>activisioncall-of-dutycall-of-duty-modern-warfare-2filmfrost-roadhollywoodinfinity-wardkeith-aremmodern-warfare-2moviesWed, 02 Dec 2009 19:00:00 EST<![CDATA[Direct2Drive running '24 Days of Christmas' sale]]>http://www.joystiq.com/2009/12/01/direct2drive-running-24-days-of-christmas-sale/http://www.joystiq.com/2009/12/01/direct2drive-running-24-days-of-christmas-sale/http://www.joystiq.com/2009/12/01/direct2drive-running-24-days-of-christmas-sale/#comments Digital distribution service Direct2Drive is celebrating the 24 days leading up to Christmas by discounting a select PC title each day from now until December 25. As the math whizzes have no doubt already divined, that's 24 discounted games! Today's game is DICE's parkour-em-up, Mirror's Edge. At the ridiculously low asking price of $4.95, it'd be a crime for PC gamers to disregard this most excellent (and very much deserving of a sequel, EA!) game from 2008.

We can personally vouch for its high levels of quality, actually. In terms of fun-to-cents ratio, you're looking at about 16 gazillion wows of entertainment value. Trust us, we did the math.

[Thanks, Jordan]

JoystiqDirect2Drive running '24 Days of Christmas' sale originally appeared on Joystiq on Tue, 01 Dec 2009 21:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>anti-mehdicedirect2driveeamirrors-edgeparkourTue, 01 Dec 2009 21:00:00 EST<![CDATA[Standalone DJ Hero controllers now available for $70]]>http://www.joystiq.com/2009/12/01/standalone-dj-hero-controllers-now-available-for-70/http://www.joystiq.com/2009/12/01/standalone-dj-hero-controllers-now-available-for-70/http://www.joystiq.com/2009/12/01/standalone-dj-hero-controllers-now-available-for-70/#comments If you've been sitting around on your fat stacks of cash, waiting to pick up an extra DJ Hero controller then now is the time, friend. Activision sent along a press release stating that the turntable controllers are now in stock at the Guitar Hero Store for $70 a pop, $40 cheaper than the regular, game-packing bundle.

With a weak showing on October's NPD charts and UK retailers slashing prices, we can't say we fully understand Activision's decision to charge so much for the turntables. From our vantage point, it looks like this: if Activision came down on the price a bit, more people would buy a second controller and have their friends try the game. Then, maybe those people would go out and buy their own set-up. Isn't that a novel idea?

JoystiqStandalone DJ Hero controllers now available for $70 originally appeared on Joystiq on Tue, 01 Dec 2009 19:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>activisiondjdj-herofreestyle-gamesfreestylegamesmusicperipheralsrhythmTue, 01 Dec 2009 19:30:00 EST<![CDATA[250GB Elite bundle with Halo 3 and ODST drops into Canada]]>http://www.joystiq.com/2009/12/01/250gb-elite-bundle-with-halo-3-and-odst-drops-into-canada/http://www.joystiq.com/2009/12/01/250gb-elite-bundle-with-halo-3-and-odst-drops-into-canada/http://www.joystiq.com/2009/12/01/250gb-elite-bundle-with-halo-3-and-odst-drops-into-canada/#comments Microsoft just pulled back the curtain on a brand-new bundle exclusively for our brothers and sisters to the north. Aside from a 250GB Xbox 360 Elite console, the bundle also includes a double dose of Bungie goodness: Halo 3 and Halo 3: ODST.

Starting today, you can get your maple syrup-soaked hands on this for a suggested retail price of $399.99 CAD. If you're a US gamer wondering why we didn't get this piece of gear down here, relax -- let Canada win this one! You have any idea how many driveways a Canadian has to shovel to earn this thing?

Joystiq250GB Elite bundle with Halo 3 and ODST drops into Canada originally appeared on Joystiq on Tue, 01 Dec 2009 18:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>bundlebungiecanadaelitehalohalo-3halo-3-odstxbox-360-eliteTue, 01 Dec 2009 18:30:00 EST<![CDATA[Amazon lists Uncharted/DualShock 3 combo pack]]>http://www.joystiq.com/2009/12/01/amazon-lists-uncharted-dualshock-3-combo-pack/http://www.joystiq.com/2009/12/01/amazon-lists-uncharted-dualshock-3-combo-pack/http://www.joystiq.com/2009/12/01/amazon-lists-uncharted-dualshock-3-combo-pack/#comments Look, if for some crazy reason you've still not gotten yourself a DualShock 3 and, even crazier, haven't played through Uncharted: Drake's Fortune, then you might want to check out this Amazon bundle -- which is set to release December 15.

For $60, you'll get a black DualShock 3 controller and experience every earth-shaking explosion in Nathan Drake's first adventure through glorious rumble or -- given the time of year -- gift your procrastinator friend or loved one with one sweet bundle, granted they haven't already acquired a new console in the last year or a new PS3 Slim.

There's no word whether Sony will offer other bundles and together the two will only save you $7 right now (Amazon is pricing the game at $27 and the controller at $40), but we still wouldn't suggest playing Uncharted without a DualShock 3. What are you, some chump on the street not getting the fullest from your games? No, you hold yourself to a higher standard.

[Thanks, Yingerman!]

JoystiqAmazon lists Uncharted/DualShock 3 combo pack originally appeared on Joystiq on Tue, 01 Dec 2009 18:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>amazondualshock-3dualshock3nathan-drakenaughty-doguncharteduncharted-drakes-fortuneTue, 01 Dec 2009 18:00:00 EST<![CDATA[DiRT 2 PC demo hits the track]]>http://www.joystiq.com/2009/12/01/dirt-2-pc-demo-hits-the-track/http://www.joystiq.com/2009/12/01/dirt-2-pc-demo-hits-the-track/http://www.joystiq.com/2009/12/01/dirt-2-pc-demo-hits-the-track/#comments The PC version of Codies racer DiRT 2 may be a bit behind the console pack, but it's crossing the finishing line in style. The extra time has allowed the team to throw a couple of more DirectXs in there (they've got it up to 11 now!) and fine-tune all of the game's tessellation.

And if you're still on the sidelines, wondering whether the game is for you (or, more importantly, if your puny rig can handle all of this Xtreme tessellation action), then why not try the game out right now? Codemasters was kind enough to hook up our sister site Big Download with a PC demo, so feel free to get a little dirty. Just, uh, change your clothes first. Your mom would kill us if you ruined that new Nickelback T-shirt.

JoystiqDiRT 2 PC demo hits the track originally appeared on Joystiq on Tue, 01 Dec 2009 16:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>codemastersdemodirtdirt-2ken-blockracingTue, 01 Dec 2009 16:30:00 EST<![CDATA[Famitsu: Metal Gear Solid Peace Walker strides into Japan on March 18]]>http://www.joystiq.com/2009/12/01/famitsu-metal-gear-solid-peace-walker-strides-into-Japan-on/http://www.joystiq.com/2009/12/01/famitsu-metal-gear-solid-peace-walker-strides-into-Japan-on/http://www.joystiq.com/2009/12/01/famitsu-metal-gear-solid-peace-walker-strides-into-Japan-on/#commentsThis week's issue of Famitsu lifts the cardboard box off Metal Gear Solid: Peace Walker's release date, outing the PSP title for a March 18, 2010 release in Japan. Given Konami's history of timely Metal Gear localizations, it might not be too long until the game reaches its excited Western audience.

We loved what we played at TGS and we're willing to bet those of you who braved the Japanese demo likely felt the same. If you were frightened by the lack of understandable words, have no fear -- an English demo is currently in the works!

JoystiqFamitsu: Metal Gear Solid Peace Walker strides into Japan on March 18 originally appeared on Joystiq on Tue, 01 Dec 2009 11:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>actionhideo-kojimajapankojima-productionskonamimetal-gear-solidmetal-gear-solid-peace-walkerrelease-datestealthTue, 01 Dec 2009 11:30:00 EST<![CDATA[Brink moved to Fall 2010; watch its S.M.A.R.T. system now]]>http://www.joystiq.com/2009/11/30/brink-moved-to-fall-2010-watch-its-s-m-a-r-t-system-now/http://www.joystiq.com/2009/11/30/brink-moved-to-fall-2010-watch-its-s-m-a-r-t-system-now/http://www.joystiq.com/2009/11/30/brink-moved-to-fall-2010-watch-its-s-m-a-r-t-system-now/#comments Back at E3, we were briefly shown Brink's S.M.A.R.T. system for navigating around the Bethesda-published FPS' environment. Our play session was mainly focused on the combat and quests of the game at the time. Now, Splash Damage's own Paul Wedgewood has been kind enough to demonstrate how it works in-game, courtesy of the G4 video past the break.

Another interesting item brought up in this video is Brink's new release date: Fall 2010. Last we heard, it was destined for a Spring 2010 release. Not so anymore!

Gallery: Brink (Xbox 360, PS3, PC)

Concept art ? Container City

Continue reading Brink moved to Fall 2010; watch its S.M.A.R.T. system now

JoystiqBrink moved to Fall 2010; watch its S.M.A.R.T. system now originally appeared on Joystiq on Mon, 30 Nov 2009 19:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>bethesdabrinkfpssmartsplash-damagewalkthroughMon, 30 Nov 2009 19:30:00 EST<![CDATA[Bioshock 2 coming to Japan, courtesy of D3 Publisher]]>http://www.joystiq.com/2009/11/30/bioshock-2-coming-to-japan-courtesy-of-d3-publisher/http://www.joystiq.com/2009/11/30/bioshock-2-coming-to-japan-courtesy-of-d3-publisher/http://www.joystiq.com/2009/11/30/bioshock-2-coming-to-japan-courtesy-of-d3-publisher/#comments Good news, Japan! D3 Publisher is localizing Bioshock 2 for you and, this time around, you won't have to wait that long to get your ADAM-soaked hands on it. Andriasang reports D3 Publisher will release the 2K Marin, et al.-developed sequel sometime in early 2010 -- presumably close to the February 9 US release date. We just hope the new Japanese ad campaign dials back the completely frightening a bit.

JoystiqBioshock 2 coming to Japan, courtesy of D3 Publisher originally appeared on Joystiq on Mon, 30 Nov 2009 18:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>2k-australia2k-games2k-marinarkane-studiosbioshockbioshock-2d3d3-publisherdigital-extremesjapanMon, 30 Nov 2009 18:00:00 EST<![CDATA[NintendoWare Weekly: Tales of Monkey Island, Bookworm, The Combatribes]]>http://www.joystiq.com/2009/11/30/nintendoware-weekly-tales-of-monkey-island-bookworm-the-comba/http://www.joystiq.com/2009/11/30/nintendoware-weekly-tales-of-monkey-island-bookworm-the-comba/http://www.joystiq.com/2009/11/30/nintendoware-weekly-tales-of-monkey-island-bookworm-the-comba/#comments If you thought last week's NintendoWare Weekly update was huge, well ... you'll probably think the same thing about this week's update! That's mostly because Nintendo provides quite the overweight offering this time, with a total of ten new titles available for your post-Thanksgiving download. Loosen that belt and make some room for more by heading past the break for the full list of this week's releases.

Continue reading NintendoWare Weekly: Tales of Monkey Island, Bookworm, The Combatribes

JoystiqNintendoWare Weekly: Tales of Monkey Island, Bookworm, The Combatribes originally appeared on Joystiq on Mon, 30 Nov 2009 12:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>aksys-gamesbookwormchristmas-clixcombatribescopter-crisisdigital-leisuredsiwareeafoto-facehudsonjc-games-incmaster-of-illusionmaster-of-illusion-expressmy-zoonintendo-dsinintendoware-weeklypopcappopcap-gamessnessolomons-keysudokusudoku-challengetales-of-monkey-islandtecmotelltale-gamesthe-combatribesvc-arcadevirtual-consolevirtual-console-arcadewiiwareMon, 30 Nov 2009 12:00:00 EST<![CDATA[EA takes 30 percent off several PC games until Monday]]>http://www.joystiq.com/2009/11/26/ea-takes-30-percent-off-several-pc-games-until-monday/http://www.joystiq.com/2009/11/26/ea-takes-30-percent-off-several-pc-games-until-monday/http://www.joystiq.com/2009/11/26/ea-takes-30-percent-off-several-pc-games-until-monday/#comments
 EA's online store is running an exciting Black Friday sale, with downloadable PC games getting 30 percent off from now until Monday. We're talking about discounts on a bunch of games here, with standouts such as Burnout Paradise The Ultimate Box for a cool $21 and Mass Effect for a very reasonable $14.

Not everything is on sale, however -- some of the newer titles like Left 4 Dead 2 and the Dragon Age Collector's Edition don't qualify (though the regular version of the latter is on sale for $35). If you're determined to get good deals on some of these newer games, we have a feeling you'll be able to find 'em somewhere.

[Via Big Download]

Check out Joystiq's Black Friday Game Deals Hub or jump to a retailer guide below:


For more Black Friday coverage, check out Black Friday Deals, Cyber Monday Sales,
And other Black Friday 2009 stories today from Walletpop.com

JoystiqEA takes 30 percent off several PC games until Monday originally appeared on Joystiq on Thu, 26 Nov 2009 12:05:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>black-fridayblack-friday-2009burnout-paradiseburnout-paradise-the-ultimate-boxdragon-age-originseaelectronic-artsleft-4-dead-2mass-effectsaleThu, 26 Nov 2009 12:05:00 EST<![CDATA[Nintendo: 80 percent of female console gamers prefer Wii]]>http://www.joystiq.com/2009/11/26/nintendo-80-percent-of-female-console-gamers-prefer-wii/http://www.joystiq.com/2009/11/26/nintendo-80-percent-of-female-console-gamers-prefer-wii/http://www.joystiq.com/2009/11/26/nintendo-80-percent-of-female-console-gamers-prefer-wii/#comments
[Source: Kotaku]
Nintendo's resident name jotter-downer and kiester-kicker recently divulged to BMO Capital Markets attendees that the Wii is outperforming its rivals when it comes to female gamers. According to its estimates (via Kotaku), 80 percent of the female console gaming crowd prefers Wii over the alternatives. With an estimated 11.7 million female console gamers in the Americas -- it's important to note this data of Nintendo's doesn't take into account DS owners or PC users -- the figure comes out to roughly nine million ladies waggling their way into the fun zone.

JoystiqNintendo: 80 percent of female console gamers prefer Wii originally appeared on Joystiq on Thu, 26 Nov 2009 03:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>bmobmo-capital-marketsbmo-capital-markets-conferencefemalereggiereggie-fils-aimeThu, 26 Nov 2009 03:00:00 EST<![CDATA[Patent details Xbox 360 hint system]]>http://www.joystiq.com/2009/11/25/patent-details-xbox-360-hint-system/http://www.joystiq.com/2009/11/25/patent-details-xbox-360-hint-system/http://www.joystiq.com/2009/11/25/patent-details-xbox-360-hint-system/#comments Microsoft must like Nintendo's new Super Guide system, because a patent has recently popped up online detailing a similar system for the Xbox 360. The core difference between Microsoft's proposed system and Nintendo's comes from community input; the patent not only touches on a way for users to submit screens and brief guides for those especially tough spots in games, but also says users will be able to include brief audio commentary and add to their screens using a digital pen feature. The system also details functionality for devs and publishers, giving their insights and guides more weight than those from the community.

It's ambitious, to say the least, and even though we foresee millions of potential Halo 3 teabagging tutorials, we're all for anything that helps us game better.

[Via Siliconera]

JoystiqPatent details Xbox 360 hint system originally appeared on Joystiq on Wed, 25 Nov 2009 20:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>microsoftpatentsuper-guideusptoWed, 25 Nov 2009 20:00:00 EST<![CDATA[GAME and Activision UK team up for Modern Warfare 2 charity event next weekend]]>http://www.joystiq.com/2009/11/25/game-and-activision-uk-team-up-for-modern-warfare-2-charity-even/http://www.joystiq.com/2009/11/25/game-and-activision-uk-team-up-for-modern-warfare-2-charity-even/http://www.joystiq.com/2009/11/25/game-and-activision-uk-team-up-for-modern-warfare-2-charity-even/#comments
 War Child International is a coalition of organizations that seeks to aid children affected by war. Activision UK and GAME have decided to pitch in and are joining up to host an online event next weekend in Modern Warfare 2, asking that UK citizens play a bit of the game on Xbox Live. The more people enlist for action online, the more Activision UK will donate to the charity.

If you're looking for more information on the event, there's a Facebook page and a Twitter account set up to help coordinate. If you've got a busy weekend ahead of you on December 4, try to make time for at least one online match. It's not every day you can make someone else's life better just by playing a video game.

JoystiqGAME and Activision UK team up for Modern Warfare 2 charity event next weekend originally appeared on Joystiq on Wed, 25 Nov 2009 19:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>activisioncall-of-dutycharitygameinfinity-wardmodern-warfaremodern-warfare-2ukwar-childwar-child-internationalxbox-liveWed, 25 Nov 2009 19:30:00 EST<![CDATA[Alienware machines now come pre-loaded with Steam]]>http://www.joystiq.com/2009/11/25/alienware-machines-now-come-pre-loaded-with-steam/http://www.joystiq.com/2009/11/25/alienware-machines-now-come-pre-loaded-with-steam/http://www.joystiq.com/2009/11/25/alienware-machines-now-come-pre-loaded-with-steam/#comments If you've got an impressive amount of money buried in your backyard and would love to own a super slick gaming machine, Alienware might be an option you're currently considering. The company has announced that its "All Powerful" systems will ship with Valve's Steam platform pre-loaded onto the system, allowing potential gamers to sign up for Modern Warfare 2 boycotts mere moments after booting the rig up.

The Steam client will also include a free copy of Portal, in case you missed most of 2007.

JoystiqAlienware machines now come pre-loaded with Steam originally appeared on Joystiq on Wed, 25 Nov 2009 14:40:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>alienwaredellportalsteamvalveWed, 25 Nov 2009 14:40:00 EST<![CDATA[Fight Night: Round 4 gets new fighters, modes, major update Dec. 3]]>http://www.joystiq.com/2009/11/24/fight-night-round-4-gets-new-fighters-modes-major-update-dec/http://www.joystiq.com/2009/11/24/fight-night-round-4-gets-new-fighters-modes-major-update-dec/http://www.joystiq.com/2009/11/24/fight-night-round-4-gets-new-fighters-modes-major-update-dec/#comments
Punch your way through to our gallery
Pugilists looking to beef up their stable of brawlers in Fight Night Round 4 will be able to do just that when EA offers up three new fighters in a DLC pack for 360 and PS3 on December 3. For the price of 160 ($2) and $1.99, respectively, you'll be able to add boxing greats Evander Holyfield, Sonny Liston and Bernard Hopkins to your virtual lineup of potential pulverizers. In addition to the new DLC, EA will also bring in the cut man to fix a few issues fighters are having with the game -- you can find the full list of fixes after the break -- and will add Old School Rules and Ring Rivalry mode. Here's the fight card:

Full bundle (Xbox 360/PS3) - 800 ($10) / $9.99
  • Evander Holyfield, Sonny Liston and Bernard Hopkins
  • Ring Rivalry game mode (allows players to choose from over 20 different match options recreating boxing's most famous matchups)
  • Old School Rules game mode (simulates the common rules of boxing prior to the establishment of the Marquis of Queensbury Rules)
Three new boxers (Holyfield, Liston and Hopkins) -- 160 ($2) / $1.99 each

Old School Rules mode -- 320 ($4) / $3.99

Ring Rivalry mode -- 160 ($2) / $1.99

Gallery: Fight Night Round 4 (DLC)

Continue reading Fight Night: Round 4 gets new fighters, modes, major update Dec. 3

JoystiqFight Night: Round 4 gets new fighters, modes, major update Dec. 3 originally appeared on Joystiq on Tue, 24 Nov 2009 22:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>boxingdlceafight-nightfight-night-round-4sportsTue, 24 Nov 2009 22:00:00 EST<![CDATA[OPM: Ubisoft writer claims 'pretty exciting' Far Cry 3 in the works]]>http://www.joystiq.com/2009/11/24/ubisoft-writer-says-team-working-on-far-cry-3-looks-pretty-exc/http://www.joystiq.com/2009/11/24/ubisoft-writer-says-team-working-on-far-cry-3-looks-pretty-exc/http://www.joystiq.com/2009/11/24/ubisoft-writer-says-team-working-on-far-cry-3-looks-pretty-exc/#comments
 Kevin Shortt, master wordsmith at Ubisoft Montreal, has allegedly confirmed to Official PlayStation Magazine UK (via CVG) that Far Cry 3 is in development at the Canadian super-studio. Most of you know that we had no problem heaping copious amounts of praise upon Far Cry 2, one of our Top 10 games of 2008, so a third installment is most certainly welcome in these parts. Sadly, Shortt didn't say whether Ubisoft has decided to go with Africa again for the setting, but offered that what he's seen of the game looks "pretty exciting."

So ... that's pretty exciting, right?

JoystiqOPM: Ubisoft writer claims 'pretty exciting' Far Cry 3 in the works originally appeared on Joystiq on Tue, 24 Nov 2009 19:30:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>far-cryfar-cry-3kevin-shorttofficial-playstation-magazineubisoftubisoft-montrealTue, 24 Nov 2009 19:30:00 EST<![CDATA[Square Enix doing CG cinematics for Deus Ex 3, interested in Thief 4]]>http://www.joystiq.com/2009/11/24/square-enix-doing-cg-cinematics-for-deus-ex-3-interested-in-thief-4/http://www.joystiq.com/2009/11/24/square-enix-doing-cg-cinematics-for-deus-ex-3-interested-in-thief-4/http://www.joystiq.com/2009/11/24/square-enix-doing-cg-cinematics-for-deus-ex-3-interested-in-thief-4/#comments "Deus Ex 3 is going to be the first project which will be a concrete product of joint effort between Square Enix and Eidos," said Stephane D'Astous, general manager of Eidos Montreal. Not to be confused with that other first collaboration between the two, the devs in Tokyo will take care of any CGI cutscenes in the upcoming threequel, while D'Astrous confirmed to Edge that the duty of putting together enticing trailers and the game's intro cinematic will also fall on the CGI-smiths at Square Enix.

D'Astrous says Square Enix was excited to contribute, also expressing interest in Thfourteeneff. It should provide a nice change of scenery for Square Enix, though we're sure it'll find a spot to squeeze in a silver-haired, effeminate hero or three.

JoystiqSquare Enix doing CG cinematics for Deus Ex 3, interested in Thief 4 originally appeared on Joystiq on Tue, 24 Nov 2009 16:39:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>deus-exdeus-ex-3eidoseidos-montrealsquare-enixthfourteeneffthi4fthiefthief-4Tue, 24 Nov 2009 16:39:00 EST<![CDATA[EA Montreal shifting focus to 'big, blockbuster-type titles']]>http://www.joystiq.com/2009/11/24/ea-montreal-shifting-focus-to-big-blockbuster-type-titles/http://www.joystiq.com/2009/11/24/ea-montreal-shifting-focus-to-big-blockbuster-type-titles/http://www.joystiq.com/2009/11/24/ea-montreal-shifting-focus-to-big-blockbuster-type-titles/#comments According to comments made to Edge by EA Montreal general manager Alain Tascan, you can expect more big action titles like Army of Two: The 40th Day from the studio. While previous Wii games, including Skate It, Boogie Superstar and the recently released Need for Speed: Nitro, have enjoyed acceptable levels of success, Tascan believes that targeting HD consoles with "fewer and bigger things" might yield improved results. It's a prudent approach, no doubt stemming from the publisher's recent layoffs.

Tascan explains that the Wii market is "a little bit unpredictable these days," further encouraging a shift to additional "big, blockbuster-type titles." We probably don't need Tascan to point out that Army of Two is "the most successful original IP EA has had in the last few years," since it's the first to get a big, blockbuster sequel ahead of Dead Space and -- can we dream? -- Mirror's Edge.

JoystiqEA Montreal shifting focus to 'big, blockbuster-type titles' originally appeared on Joystiq on Tue, 24 Nov 2009 11:45:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>army-of-twoarmy-of-two-the-40th-dayboogieboogie-superstareaea-montrealelectronic-artsskate-itTue, 24 Nov 2009 11:45:00 EST<![CDATA[Rumor: Kingdom Hearts: Birth by Sleep not releasing on PSN]]>http://www.joystiq.com/2009/11/23/rumor-kingdom-hearts-birth-by-sleep-not-releasing-on-psn/http://www.joystiq.com/2009/11/23/rumor-kingdom-hearts-birth-by-sleep-not-releasing-on-psn/http://www.joystiq.com/2009/11/23/rumor-kingdom-hearts-birth-by-sleep-not-releasing-on-psn/#comments There's a rumor circulating around the wild wild web right now that says Square Enix may not be looking to offer Kingdom of Hearts: Birth by Sleep via digital distribution on PSN, possibly adding insult to injury for all PSP Go owners out there. The rumor originated from Twitter user Magunus, who apparently attended a recent PlayStation event in Japan (we can't figure out which event this is referring to, and there's no mention on the official Japanese blog) where a clerk confirmed it, citing "copyright issues."

This strikes us as odd not only because of the tenuous nature by which this has been reported, but because a lot of Disney Interactive's titles have been made available via digital distribution in the past. We've contacted both Square Enix and Disney Interactive about this and will be sure to let you know what we hear back.

[Via Sankaku Complex (site NSFW)]

JoystiqRumor: Kingdom Hearts: Birth by Sleep not releasing on PSN originally appeared on Joystiq on Mon, 23 Nov 2009 21:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>disneydisney-interactive-studioskingdom-heartskingdom-hearts-birth-by-sleeppsnsquare-enixMon, 23 Nov 2009 21:00:00 EST<![CDATA[BioShock cosplay recreates Rapture at the Aquarium]]>http://www.joystiq.com/2009/11/23/bioshock-cosplay-recreates-rapture-at-the-aquarium/http://www.joystiq.com/2009/11/23/bioshock-cosplay-recreates-rapture-at-the-aquarium/http://www.joystiq.com/2009/11/23/bioshock-cosplay-recreates-rapture-at-the-aquarium/#comments Sometimes an idea is just so good, you can hardly believe you came up with it. That must be how Harrison Krix felt after creating the elaborate and awesome Big Daddy costume you see above -- not since BioShock released have we been so eager to heap praise on something. Well, Mr. Krix, we hope you suffocate on our affection, because taking your costume to the Georgia Aquarium for some underwater snapshots has to be the best idea ever.

If you're scratching your head, wondering just where you've seen these two before, let us help you: right here on our website. Krix's girlfriend (holding another of his creations in the pic above, the ADAM syringe) is quite the cosplayer, which initially got Krix into the game of making things from games. Take notes, gents! That's how you woo the ladies.

[Via Geekologie]

JoystiqBioShock cosplay recreates Rapture at the Aquarium originally appeared on Joystiq on Mon, 23 Nov 2009 19:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>adamadam-syringeaquariumbig-daddybioshockdim-horizon-studioharrison-krixvolpin-propsMon, 23 Nov 2009 19:00:00 EST